[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV55248.1


[Show Plain Result]

## Summary of Sequence Search
   1::187
   1::180  2.5e-43 39.3% 0049241 00492411 1/1   proteins                                
   1::179  1.7e-40 36.7% 0049507 00495071 1/1   proteins                                
   1::186  3.6e-40 43.9% 0048395 00483951 1/1   proteins                                
   1::177  8.3e-32 31.6% 0049548 00495481 1/1   proteins                                
   1::186  4.9e-31 29.3% 0049022 00490221 1/1   proteins                                
   1::178  8.1e-30 33.3% 0049640 00496401 1/1   proteins                                
   1::183  4.4e-29 30.7% 0043718 00437181 1/1   proteins                                
   1::187  9.7e-28 32.2% 0052813 00528131 1/1   proteins                                
   1::188  4.6e-26 31.3% 0051281 00512811 1/1   proteins                                
   2::180  9.6e-26 33.3% 0049201 00492011 1/1   proteins                                
   1::184  1.6e-25 33.0% 0042957 00429571 1/1   proteins                                
   1::178  2.9e-21 29.7% 0046417 00464171 1/1   proteins                                
   1::187  3.1e-21 26.0% 0051705 00517051 1/1   proteins                                
   1::178  1.9e-19 30.7% 0046267 00462671 1/1   proteins                                
   1::188  5.4e-13 30.7% 0036778 00367781 1/1   proteins                                
   2::185  1.1e-12 32.9% 0051274 00512741 1/1   proteins                                
   1::183  1.6e-11 28.5% 0051820 00518201 1/1   proteins                                
   1::172  1.5e-10 31.7% 0044895 00448951 1/1   proteins                                
   1::187


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLLAIAGSLRENSYNRQLAEAAGALMREKHPEVGYGILRWEDVPFMNQDIEHPAPEAVMRVREAVREAD
00492411   1/1  mkilvivgSlrkgsntrklaeaaaellee...gaevelidladlplplldgdleglpddvqellekllaa
00495071   1/1  MkiliivgsprkgsntralaeaaaegleeallelhpgaevelidladlnlPlldedllgallcltegqca
00483951   1/1  mkilvivGSlrkgsnnrklaealaelleeagaevelidladlnlplldgc.....pddvqelrekiaeaD
00495481   1/1  MkkiliiygSprlkgsntralaeaaaegleealpgaevelidladlplppcdgclecalktgacvlpddv
00490221   1/1  MsmkiliiygSprkgsntralaeaaaegleeagaevelidladldldpcldcdlcaakgkcvelltlaqe
00496401   1/1  smmkiliiygSprlkgsntralaeaaaegleealpgaevelidladldlPlldedlcigcfaclkelseg
00437181   1/1  MKvlviygSprgknsntrklaeaaaeglee...gaevevidladlpippclgcllcalgfkdgkcaqkva
00528131   1/1  llledllllddlpvldldllllidllellimstpmkilvlygSprrgsntrklaeaaaegleaagaevei
00512811   1/1  aPMkiliiygSpr..gnteklaeaiaegleeagaevelidladlplppclgdlecltegecvlpddveel
00492011   1/1  -KiliiygSprkgsntralaeaaae.....gaevelidladldlppclgdlecakgkcplpddveallek
00429571   1/1  mmmkiliingspregsntralaeaaleglkepgaevevidLydlnidpcldcddcaallkppegltlsle
00464171   1/1  mmmkiLiinasprenslsraladaalegleeaghevevldLydlpfdpcldcddcaakftppegltaeqe
00517051   1/1  MmkilvvygSpr..gnTeklaeaiaegaeeagaevelidvaelplpeclacgdcplkddlealledllea
00462671   1/1  mmmkiLiingspregsltraladaalegleeaghevevidLyalpfdpcldcddcaalftppegltpeqk
00367781   1/1  mmmkvlivygSmy..gnteklaeaiaeglre..agvevelidlsdtdl.............delleelld
00512741   1/1  -gekkilvlygSlt..gntellaealaegleaagvevelvdladldlpdl...............leell
00518201   1/1  MmkiliiygSpt..GnTeklaeaiaegleav.agvevelidvsdadp.................edllea
00448951   1/1  kkmkkvlivygSmy..gnteklAeaiaeglke..agvevelldlselda..........peilelleell


                         -         -         *         -         -         -         -:140
query           GLWLFSPEYNHAIPGPLKNLLDWLSRPVSATEAQVLAEKPVALAGASIGMSGASHAQDQLVGMLSFLDAH
00492411   1/1  DglvfatPeYngsipglLKnalDrlsrpg....gkllagKpvalvstsggalgglraleqlrlilgflga
00495071   1/1  lpddvaeliekllaaDalvfvtPeYngsiPalLKnfiDrvsrp........lkgKpvllvstsgg..ggl
00483951   1/1  aivlvtPeYngsipgaLKnalDwlsrpw.......lagkpvalvavsgggsgglraleqlrqvlaflgal
00495481   1/1  qallalsdallekllaaDaivfgtPeyngsvpallKnfiDrvlragfafgytglggggllkgKpaalivt
00490221   1/1  ellalkegllpddvaellekllaaDaivfgtPvyngsvpaqlKnfiDrvlragfafgygglgpvgllkgK
00496401   1/1  ecvlpddvaallekllaaDaivfgtPeyngsvpallKnfiDrvlrpgfafgygglgpvgllkgKpaalvv
00437181   1/1  ddvaelleklleaDaivfgsPvyngsvpaqlKafiDrlsrlg...pvgllkgKvvavvttsgg.ggaeaa
00528131   1/1  idladlplplgcidclp...ddvaelledllaadgivvgsPtyngsmpallKnflDrllllg..gsvgll
00512811   1/1  leklleaDaiilgtPtyngsvpaqlknflDrvlrlgf...ggllkgKpaalfgtsggpgggaerallqlr
00492011   1/1  llaaDaivfgtPeyngsvpaqlKnfiDrvsrlgfafgydgpggllkgKpaalvvtsggpgggylesalry
00429571   1/1  ealalgecalpddveellekllaaDaivfafPlYwfsvPallKnfiDrvlragfafgytgngpegllkgK
00464171   1/1  ealalgecvlkddvaeeqekllaADvivfafPlywfgvPalLKgwiDrvlragfafgytgdgpvgllkgK
00517051   1/1  DgiilGsPtyfgsvsaqlkafldrlsrlw...lsgalagKpaavftssggsgggqetallslrtlllhlg
00462671   1/1  qalalgkcplpddvealqekllaADaivfafPlywfsvPallKgwiDrvlraGfafgyggngpvgllkgK
00367781   1/1  adaiilGsPtynggvlpqlknfldalsgld.......lkgKpvavfgs...gggsgeavdllrellkelg
00512741   1/1  dadalvVgsPtyngsipgllkafldrllglg.......lkgkkvavfgsg.g..gsggavkqlrellael
00518201   1/1  DgiilGsPtygggvpgqlkdfldrlsglwl....gllkgKpaavfgsgggsgggfedalkylrkllkelg
00448951   1/1  dadalilgsPtyggeippqlkdfldllggla.......lkgKlaavfg.sggwfgg..avktleellkel


                         +         -         -         -         -         *         -:210
query           VMNKPRLCIPHIATQADEQGRLKLESSAPYLEAQADAFVRFVEREQG-----------------------
00492411   1/1  vvvpsvvvalgkalelfdedgllldeellerlkelleelv------------------------------
00495071   1/1  rallylrtilgflgatvvpsvvalgvaagelfdedgelt-------------------------------
00483951   1/1  vipsqvlilgag...fdedgvltdeellerledlldelvkllklle------------------------
00495481   1/1  sggpggglaaesalrylltilgflgmpvvglvlaegv---------------------------------
00490221   1/1  paalvvts.ggpggayaaggaegtlrqlltpllrgilgflgitvlg------------------------
00496401   1/1  tsggpggglaaetalrplltilgflgmtvvglvlaegv--------------------------------
00437181   1/1  lqylrtilaflgmivvglvyaegvllgpgdevllgsaygafdv---------------------------
00528131   1/1  agKpaavfvtg.ggsggelaleqlrtllahlgmivvp.pglsvgvag-----------------------
00512811   1/1  tilaflgmivvglg.laigvafdafgaplgastlaggvlldedelela----------------------
00492011   1/1  lrtilaflgmtvvgsvyaegv......dfgevekdeeale------------------------------
00429571   1/1  kvllvvtsggpeeaysaggpnggvddlltpllrgilgflGmtvl--------------------------
00464171   1/1  kallivtsGgpeeaysegggag.alldlllpylrgilg--------------------------------
00517051   1/1  mivvglglavgglldefrggspygastfagidggvlp.deeeletar-----------------------
00462671   1/1  kalvivtsGgpeeayseggpaggledlllpylrgilgf--------------------------------
00367781   1/1  akvvgepllv...........kgapdeedletaeelgkrlaellkklk----------------------
00512741   1/1  galvvplgvllv..........dedpdeealerieelgeelakll-------------------------
00518201   1/1  mivvglgyfagal.ggspygallaegapdeedlerarelgkrl---------------------------
00448951   1/1  gakvv..plleikgspt.dleeleelgkelak--------------------------------------