[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV55249.1


[Show Plain Result]

## Summary of Sequence Search
   1::166
   5::168  6.6e-32 34.2% 0046133 00461331 1/1   like                                    
   1::166


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGAARRIAVFCVGNKLMLDDGVGPAVYEELLTRYDIPDNVELFDLGCLSLNMIERVREYDVIITVDAVDG
00461331   1/1  ----kkilvlGiGNilrgDdGvGvlvaerLeellelppgvevidggtlglelllllegadrviivDAvla


                         -         -         *         -         -         -         -:140
query           TDADPGTVFRFEPDAMARHSGATASLHDLKLVDLFDAAALLGYEAEGLCLGMQVENPSPAVVTVGLTPKV
00461331   1/1  lglepGtvylldldelpalldlllslHqlgllelLallrllgglppevvllgiepasle...lglgLspe


                         +         -         -         -         -         *         -:210
query           DAALPLLVETVAGELARLGSPLRARA--------------------------------------------
00461331   1/1  vaaaveeavelilelleelgvallrvee------------------------------------------