[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV55343.1


[Show Plain Result]

## Summary of Sequence Search
   1::71
   1::69   1.6e-12 24.6% 0051234 00512341 1/1   a repressor-like DNA-binding domains    
   1::73   5.9e-12 23.3% 0051908 00519081 1/1   a repressor-like DNA-binding domains    
   2::73   1.5e-11 25.0% 0051249 00512491 1/1   a repressor-like DNA-binding domains    
   9::69   3.6e-11 31.1% 0049999 00499991 1/1   a repressor-like DNA-binding domains    
   4::72   3.7e-11 24.6% 0050823 00508231 1/1   a repressor-like DNA-binding domains    
   9::72   7.7e-11 28.1% 0045855 00458551 1/1   a repressor-like DNA-binding domains    
   5::73   1.1e-10 24.6% 0052016 00520161 1/1   a repressor-like DNA-binding domains    
   8::69   1.6e-10 26.2% 0051844 00518441 1/1   a repressor-like DNA-binding domains    
   6::70   3.8e-10 27.7% 0049180 00491801 1/1   a repressor-like DNA-binding domains    
   4::71   5.7e-10 26.5% 0051711 00517111 1/1   a repressor-like DNA-binding domains    
   6::72   9.2e-10 23.9% 0045765 00457651 1/1   a repressor-like DNA-binding domains    
   8::69   1.2e-09 26.2% 0043707 00437071 1/1   a repressor-like DNA-binding domains    
   5::69   1.9e-09 27.7% 0046409 00464091 1/1   a repressor-like DNA-binding domains    
  10::69   2.8e-09 30.5% 0043143 00431431 1/1   a repressor-like DNA-binding domains    
   8::72   4.7e-09 26.6% 0052264 00522641 1/1   a repressor-like DNA-binding domains    
   5::68   1.7e-05 29.7% 0038966 00389661 1/1   a repressor-like DNA-binding domains    
   1::71


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKSDGRRIILGKTIKMLREEQHLSQRRFALMVGTNQTHLWQIECGQVSVGIDLLCRIADGLDIKVKDLID
00512341   1/1  lllldlllllgerlrelRkelglsqeeLAellgvsrstiskiergkrnpsletllklaealgvsldell-
00519081   1/1  llllmellmalgerlrelRkerglsqeeLAellgvsrstiskiengkrnpsletllklaealgvsldell
00512491   1/1  -lmmlllmalgerlrelRkerglsqeeLAellgvsrstlsriErgkrnpsletllklaealgvsldellg
00499991   1/1  --------llgnrlkelRkekglsqeeLAellgvsrstiskiErgkrnpslelllklaealgvsldell-
00508231   1/1  ---llllmtlgerlkelRkekgltqeeLAeklgvsrstiskiEngkrlpsletllklakalgvsldellg
00458551   1/1  --------llgerlkelRkergltqeeLAellgvsrstlskiengkkrnpsletllklakalgvsldeLl
00520161   1/1  ----lllltlgerlkelReelgltqeeLAellgvsrstiskwEngklrnpsletllklaealgvsldell
00518441   1/1  -------lkiGellkelRkekgltqeelaekl.vsrsylskiEngkrnpsletllklaealgvsldell-
00491801   1/1  -----kllkklltklelpvdirlgkrlrlrRkelgltQeeLAeklGvtqqqvskyerGknrlsasrllkl
00517111   1/1  ---mlllmllgerLkelrkelgltqeelAellgvsqstisrlengkvrnpsletllklakalgvsleell
00457651   1/1  -----mdlellgerlrelRkelgltqeeLAellgvsrstiskiEngkrnpsletllklakalgvsldeLl
00437071   1/1  -------lllgerlralRkalgltqeeLAeklgvsrstiskiEngkrlps.elllklaealgvsldyLl-
00464091   1/1  ----lleslllmmlrlelgellraarkekgltqeeLAeatglsevyisaielGqrspslelalklaeaL-
00431431   1/1  ---------llgerlkelRkelgltqeeLAeklgvsrstiskiengkrlps.elllklakalgvsldyL-
00522641   1/1  -------mkllgerlrelRkelgltqeeLAellgvsrstiskiErgkrnps.elllklakalgvsldeLl
00389661   1/1  ----kellalkeeedldledeveellredslivaeelkelrkehnisQkelAeatGvsqstlSqllng--


                         -         -         *         -         -         -         -:140
query           F---------------------------------------------------------------------
00512341   1/1  ----------------------------------------------------------------------
00519081   1/1  ege-------------------------------------------------------------------
00512491   1/1  gee-------------------------------------------------------------------
00499991   1/1  ----------------------------------------------------------------------
00508231   1/1  ge--------------------------------------------------------------------
00458551   1/1  gg--------------------------------------------------------------------
00520161   1/1  gge-------------------------------------------------------------------
00518441   1/1  ----------------------------------------------------------------------
00491801   1/1  ----------------------------------------------------------------------
00517111   1/1  g---------------------------------------------------------------------
00457651   1/1  gg--------------------------------------------------------------------
00437071   1/1  ----------------------------------------------------------------------
00464091   1/1  ----------------------------------------------------------------------
00431431   1/1  ----------------------------------------------------------------------
00522641   1/1  ll--------------------------------------------------------------------
00389661   1/1  ----------------------------------------------------------------------