[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV55454.1


[Show Plain Result]

## Summary of Sequence Search
   1::1228
 972::1191 5.9e-67 40.9% 0042280 00422802 2/2   p containing nucleoside triphosphate hy 
 331::573  1.1e-65 36.2% 0042280 00422801 1/2   p containing nucleoside triphosphate hy 
 972::1209 5.3e-64 37.8% 0037958 00379582 2/2   p containing nucleoside triphosphate hy 
 972::1209 1.1e-63 37.8% 0048220 00482202 2/2   p containing nucleoside triphosphate hy 
 972::1229 2.4e-63 38.2% 0049080 00490802 2/2   p containing nucleoside triphosphate hy 
 972::1230 3.2e-63 37.1% 0051025 00510252 2/2   p containing nucleoside triphosphate hy 
 972::1208 7.4e-63 37.6% 0053059 00530592 2/2   p containing nucleoside triphosphate hy 
 352::591  6.2e-62 35.3% 0037958 00379581 1/2   p containing nucleoside triphosphate hy 
 336::590  1.1e-61 35.3% 0053059 00530591 1/2   p containing nucleoside triphosphate hy 
 972::1191 2.5e-61 43.1% 0036790 00367902 2/2   p containing nucleoside triphosphate hy 
 351::591    5e-61 36.5% 0048220 00482201 1/2   p containing nucleoside triphosphate hy 
 972::1210   6e-61 36.8% 0048226 00482262 2/2   p containing nucleoside triphosphate hy 
 352::612  1.7e-60 35.9% 0051025 00510251 1/2   p containing nucleoside triphosphate hy 
 972::1214   2e-60 36.2% 0045860 00458602 2/2   p containing nucleoside triphosphate hy 
 352::585  2.1e-60 40.8% 0049080 00490801 1/2   p containing nucleoside triphosphate hy 
 972::1195 2.8e-60 40.7% 0037898 00378982 2/2   p containing nucleoside triphosphate hy 
 972::1205 3.9e-60 41.1% 0050943 00509432 2/2   p containing nucleoside triphosphate hy 
 974::1187 7.5e-60 40.6% 0039041 00390412 2/2   p containing nucleoside triphosphate hy 
 966::1206 8.7e-60 37.1% 0047589 00475892 2/2   p containing nucleoside triphosphate hy 
 972::1205   2e-59 38.9% 0047599 00475992 2/2   p containing nucleoside triphosphate hy 
 352::573  3.7e-59 41.3% 0036790 00367901 1/2   p containing nucleoside triphosphate hy 
 335::574  9.3e-59 42.6% 0042496 00424961 1/2   p containing nucleoside triphosphate hy 
 972::1210   1e-58 38.0% 0050274 00502742 2/2   p containing nucleoside triphosphate hy 
 340::587  1.8e-58 37.1% 0047599 00475991 1/2   p containing nucleoside triphosphate hy 
 972::1206 1.9e-58 38.3% 0042070 00420702 2/2   p containing nucleoside triphosphate hy 
 342::584    4e-58 39.3% 0044086 00440861 1/2   p containing nucleoside triphosphate hy 
 352::592  6.5e-58 35.7% 0048226 00482261 1/2   p containing nucleoside triphosphate hy 
 950::1192 6.5e-58 39.9% 0042496 00424962 2/2   p containing nucleoside triphosphate hy 
 348::588  9.9e-58 35.0% 0047589 00475891 1/2   p containing nucleoside triphosphate hy 
 352::587  9.9e-58 37.7% 0050943 00509431 1/2   p containing nucleoside triphosphate hy 
 354::569  2.2e-57 38.7% 0039041 00390411 1/2   p containing nucleoside triphosphate hy 
 352::576  8.7e-57 38.5% 0037898 00378981 1/2   p containing nucleoside triphosphate hy 
 972::1195 1.7e-56 39.6% 0042557 00425572 2/2   p containing nucleoside triphosphate hy 
 962::1202 1.9e-56 37.6% 0044086 00440862 2/2   p containing nucleoside triphosphate hy 
 352::576  2.2e-56 37.7% 0042070 00420701 1/2   p containing nucleoside triphosphate hy 
 966::1195 4.7e-56 37.6% 0050044 00500442 2/2   p containing nucleoside triphosphate hy 
 973::1204 6.5e-56 39.4% 0040410 00404102 2/2   p containing nucleoside triphosphate hy 
 967::1192 6.8e-56 36.3% 0046697 00466972 2/2   p containing nucleoside triphosphate hy 
 354::585  1.2e-55 35.8% 0045860 00458601 1/2   p containing nucleoside triphosphate hy 
 352::592  4.6e-55 34.3% 0050274 00502741 1/2   p containing nucleoside triphosphate hy 
 349::574  1.7e-54 35.4% 0046697 00466971 1/2   p containing nucleoside triphosphate hy 
 920::1195 1.3e-53 35.7% 0037960 00379602 2/2   p containing nucleoside triphosphate hy 
 348::576  1.4e-53 35.9% 0050044 00500441 1/2   p containing nucleoside triphosphate hy 
 353::586  5.6e-53 37.1% 0040410 00404101 1/2   p containing nucleoside triphosphate hy 
 352::576  5.8e-53 37.5% 0042557 00425571 1/2   p containing nucleoside triphosphate hy 
 977::1191 5.9e-53 39.7% 0046693 00466932 2/2   p containing nucleoside triphosphate hy 
 963::1193 8.3e-52 39.2% 0036121 00361212 2/2   p containing nucleoside triphosphate hy 
 972::1180 8.5e-52 36.9% 0043607 00436072 2/2   p containing nucleoside triphosphate hy 
 317::556  1.1e-51 36.1% 0043651 00436511 1/2   p containing nucleoside triphosphate hy 
 296::577  2.5e-51 32.7% 0037960 00379601 1/2   p containing nucleoside triphosphate hy 
 343::575  2.7e-51 38.7% 0036121 00361211 1/2   p containing nucleoside triphosphate hy 
 938::1174   4e-51 35.1% 0043651 00436512 2/2   p containing nucleoside triphosphate hy 
 359::573  7.1e-51 38.8% 0046693 00466931 1/2   p containing nucleoside triphosphate hy 
 352::594  1.6e-50 38.5% 0046869 00468691 1/2   p containing nucleoside triphosphate hy 
 972::1206 1.8e-49 38.6% 0046869 00468692 2/2   p containing nucleoside triphosphate hy 
 358::577  2.1e-49 41.2% 0048545 00485451 1/2   p containing nucleoside triphosphate hy 
 352::562  3.4e-49 34.4% 0043607 00436071 1/2   p containing nucleoside triphosphate hy 
 371::584  4.9e-48 38.0% 0046860 00468601 1/2   p containing nucleoside triphosphate hy 
 979::1205 5.9e-48 39.9% 0048545 00485452 2/2   p containing nucleoside triphosphate hy 
 369::584  6.5e-47 37.8% 0044893 00448931 1/2   p containing nucleoside triphosphate hy 
 350::575  1.4e-45 42.5% 0046945 00469451 1/2   p containing nucleoside triphosphate hy 
 989::1202 2.7e-45 38.5% 0046860 00468602 2/2   p containing nucleoside triphosphate hy 
 374::583  1.3e-44 36.6% 0048593 00485931 1/2   p containing nucleoside triphosphate hy 
 971::1200 1.7e-44 42.4% 0046945 00469452 2/2   p containing nucleoside triphosphate hy 
 972::1194 3.3e-44 42.1% 0037230 00372302 2/2   p containing nucleoside triphosphate hy 
 377::564  5.5e-44 42.1% 0042605 00426051 1/2   p containing nucleoside triphosphate hy 
 946::1198   1e-43 30.0% 0049825 00498252 2/2   p containing nucleoside triphosphate hy 
 972::1200 1.5e-43 40.9% 0042214 00422142 2/2   p containing nucleoside triphosphate hy 
 995::1183 1.5e-43 42.4% 0042605 00426052 2/2   p containing nucleoside triphosphate hy 
 352::574  3.9e-43 39.1% 0042214 00422141 1/2   p containing nucleoside triphosphate hy 
 992::1201   4e-43 42.2% 0048593 00485932 2/2   p containing nucleoside triphosphate hy 
 655::957  5.3e-42 22.9% 0042281 00422812 2/2   ransporter transmembrane region         
   1::344  8.9e-42 21.2% 0042281 00422811 1/2   ransporter transmembrane region         
 987::1202 8.9e-42 41.2% 0044893 00448932 2/2   p containing nucleoside triphosphate hy 
 342::575    1e-41 34.5% 0048852 00488521 1/2   p containing nucleoside triphosphate hy 
 351::580  1.2e-41 34.6% 0049825 00498251 1/2   p containing nucleoside triphosphate hy 
 346::587  1.4e-41 30.4% 0036850 00368501 1/2   p containing nucleoside triphosphate hy 
 341::575  1.8e-41 35.5% 0036748 00367481 1/2   p containing nucleoside triphosphate hy 
 968::1193 4.9e-41 38.1% 0036748 00367482 2/2   p containing nucleoside triphosphate hy 
 962::1195 6.7e-41 37.1% 0048852 00488522 2/2   p containing nucleoside triphosphate hy 
 968::1201 3.7e-40 39.1% 0043798 00437982 2/2   p containing nucleoside triphosphate hy 
 341::576  7.3e-40 36.8% 0037230 00372301 1/2   p containing nucleoside triphosphate hy 
 655::971  1.5e-39 23.4% 0053060 00530602 2/2   ransporter transmembrane region         
 368::588  3.2e-39 36.4% 0047537 00475371 1/2   p containing nucleoside triphosphate hy 
 352::607  4.8e-39 34.7% 0043798 00437981 1/2   p containing nucleoside triphosphate hy 
 308::572  5.8e-38 30.3% 0037163 00371631 1/2   p containing nucleoside triphosphate hy 
 981::1206   9e-38 35.5% 0036850 00368502 2/2   p containing nucleoside triphosphate hy 
   3::344  2.4e-37 20.9% 0053060 00530601 1/2   ransporter transmembrane region         
 354::573  3.1e-37 40.4% 0049611 00496111 1/2   p containing nucleoside triphosphate hy 
 974::1191 2.1e-36 36.6% 0049611 00496112 2/2   p containing nucleoside triphosphate hy 
 986::1204 5.1e-36 39.8% 0047537 00475372 2/2   p containing nucleoside triphosphate hy 
 971::1190 3.5e-35 35.2% 0037163 00371632 2/2   p containing nucleoside triphosphate hy 
 965::1195 1.2e-34 32.4% 0049537 00495372 2/2   p containing nucleoside triphosphate hy 
 986::1194 1.2e-34 37.5% 0050337 00503372 2/2   p containing nucleoside triphosphate hy 
 984::1195 2.5e-34 40.7% 0053253 00532532 2/2   arboxykinase-like                       
 368::576  5.2e-34 32.7% 0050337 00503371 1/2   p containing nucleoside triphosphate hy 
 345::574  1.2e-33 35.6% 0049537 00495371 1/2   p containing nucleoside triphosphate hy 
 997::1154 1.3e-33 40.8% 0038144 00381442 2/2   p containing nucleoside triphosphate hy 
 348::574  3.1e-33 35.7% 0050061 00500611 1/2   p containing nucleoside triphosphate hy 
 366::596  5.4e-33 38.7% 0053253 00532531 1/2   arboxykinase-like                       
 972::1187 1.6e-32 34.6% 0046479 00464792 2/2   p containing nucleoside triphosphate hy 
 962::1195 5.6e-32 36.7% 0050061 00500612 2/2   p containing nucleoside triphosphate hy 
 991::1139 4.4e-31 46.9% 0048047 00480472 2/2   p containing nucleoside triphosphate hy 
 995::1187 5.6e-31 36.1% 0041412 00414122 2/2   p containing nucleoside triphosphate hy 
 965::1194 6.7e-31 41.2% 0043794 00437942 2/2   p containing nucleoside triphosphate hy 
 965::1201 1.4e-29 34.0% 0049503 00495032 2/2   p containing nucleoside triphosphate hy 
 352::570  1.7e-29 32.2% 0046479 00464791 1/2   p containing nucleoside triphosphate hy 
 349::574  1.9e-29 36.2% 0049503 00495031 1/2   p containing nucleoside triphosphate hy 
 379::535    2e-29 34.6% 0038144 00381441 1/2   p containing nucleoside triphosphate hy 
 377::575  2.1e-29 32.4% 0041412 00414121 1/2   p containing nucleoside triphosphate hy 
 347::580  2.2e-29 37.9% 0043794 00437941 1/2   p containing nucleoside triphosphate hy 
 363::571  2.4e-29 37.2% 0046276 00462761 1/2   p containing nucleoside triphosphate hy 
 982::1171   6e-29 36.0% 0047841 00478412 2/2   arboxykinase-like                       
 981::1190 7.9e-29 38.2% 0046276 00462762 2/2   p containing nucleoside triphosphate hy 
 981::1205 8.5e-29 28.6% 0037926 00379262 2/2   p containing nucleoside triphosphate hy 
 374::547  1.2e-28 37.6% 0045157 00451571 1/2   p containing nucleoside triphosphate hy 
 993::1165 1.2e-28 39.1% 0045157 00451572 2/2   p containing nucleoside triphosphate hy 
 377::567  2.3e-28 35.8% 0047538 00475381 1/2   p containing nucleoside triphosphate hy 
 371::583  8.6e-28 33.7% 0049073 00490731 1/2   p containing nucleoside triphosphate hy 
 373::521  1.3e-27 38.8% 0048047 00480471 1/2   p containing nucleoside triphosphate hy 
 347::575  5.5e-27 26.6% 0037926 00379261 1/2   p containing nucleoside triphosphate hy 
 996::1185 1.4e-26 42.0% 0047538 00475382 2/2   p containing nucleoside triphosphate hy 
 995::1192 1.5e-26 35.4% 0045731 00457312 2/2   p containing nucleoside triphosphate hy 
 998::1204 2.5e-26 35.0% 0051289 00512892 2/2   p containing nucleoside triphosphate hy 
 996::1155   3e-26 35.2% 0048410 00484102 2/2   p containing nucleoside triphosphate hy 
 969::1166 6.5e-26 37.2% 0037996 00379962 2/2   p containing nucleoside triphosphate hy 
 354::549  7.4e-26 36.2% 0037996 00379961 1/2   p containing nucleoside triphosphate hy 
 366::546  9.6e-26 38.1% 0047552 00475521 1/2   arboxykinase-like                       
 378::537  2.4e-25 33.3% 0048410 00484101 1/2   p containing nucleoside triphosphate hy 
 989::1208 2.7e-25 33.5% 0049073 00490732 2/2   p containing nucleoside triphosphate hy 
 996::1182 5.5e-25 39.0% 0049657 00496572 2/2   p containing nucleoside triphosphate hy 
 355::575  1.3e-24 29.5% 0048957 00489571 1/2   p containing nucleoside triphosphate hy 
 365::553  1.4e-24 32.2% 0047841 00478411 1/2   arboxykinase-like                       
 983::1164 1.5e-24 39.2% 0047552 00475522 2/2   arboxykinase-like                       
 377::574  1.6e-24 34.5% 0045731 00457311 1/2   p containing nucleoside triphosphate hy 
 373::572  1.7e-24 26.2% 0047073 00470731 1/2   p containing nucleoside triphosphate hy 
 344::576  5.8e-24 35.3% 0044438 00444381 1/2   p containing nucleoside triphosphate hy 
 345::468  1.7e-23 28.7% 0038720 00387201 1/2   p containing nucleoside triphosphate hy 
 945::1182   2e-23 26.8% 0036857 00368572 2/2   p containing nucleoside triphosphate hy 
 354::579  2.4e-23 27.5% 0050374 00503741 1/2   p containing nucleoside triphosphate hy 
 965::1086 3.8e-23 30.3% 0038720 00387202 2/2   p containing nucleoside triphosphate hy 
 329::564  4.3e-23 23.4% 0036857 00368571 1/2   p containing nucleoside triphosphate hy 
 378::581  2.7e-22 31.9% 0049343 00493431 1/2   p containing nucleoside triphosphate hy 
 380::573  4.4e-22 31.7% 0051289 00512891 1/2   p containing nucleoside triphosphate hy 
 995::1177 5.5e-22 35.5% 0047797 00477972 2/2   p containing nucleoside triphosphate hy 
 379::594  6.2e-22 32.3% 0049657 00496571 1/2   p containing nucleoside triphosphate hy 
 982::1167 7.4e-22 32.3% 0047844 00478442 2/2   arboxykinase-like                       
 996::1179 7.5e-22 36.2% 0049919 00499192 2/2   p containing nucleoside triphosphate hy 
 975::1207 1.4e-21 27.2% 0048957 00489572 2/2   p containing nucleoside triphosphate hy 
 977::1179 1.9e-21 32.5% 0043440 00434402 2/2   p containing nucleoside triphosphate hy 
 997::1186   4e-21 34.8% 0053350 00533502 2/2   p containing nucleoside triphosphate hy 
 366::576  4.8e-21 33.6% 0051325 00513251 1/2   p containing nucleoside triphosphate hy 
 998::1184 6.3e-21 25.6% 0051376 00513762 2/2   p containing nucleoside triphosphate hy 
 346::594  6.6e-21 28.7% 0040419 00404191 1/2   p containing nucleoside triphosphate hy 
 996::1199 1.2e-20 30.9% 0049343 00493432 2/2   p containing nucleoside triphosphate hy 
 316::482    2e-20 30.1% 0049577 00495771 1/2   p containing nucleoside triphosphate hy 
 950::1200   2e-20 28.3% 0050374 00503742 2/2   p containing nucleoside triphosphate hy 
 379::572  3.1e-20 31.6% 0053350 00533501 1/2   p containing nucleoside triphosphate hy 
 357::561  4.8e-20 32.9% 0043440 00434401 1/2   p containing nucleoside triphosphate hy 
 379::523  6.5e-20 34.4% 0049919 00499191 1/2   p containing nucleoside triphosphate hy 
 377::560  9.8e-20 30.6% 0047797 00477971 1/2   p containing nucleoside triphosphate hy 
 344::563  1.7e-19 32.5% 0040678 00406781 1/2   p containing nucleoside triphosphate hy 
 994::1195 2.5e-19 35.4% 0046441 00464412 2/2   p containing nucleoside triphosphate hy 
 365::549  2.7e-19 33.1% 0047844 00478441 1/2   arboxykinase-like                       
 998::1179 3.7e-19 32.7% 0048702 00487022 2/2   p containing nucleoside triphosphate hy 
 956::1196 4.7e-19 34.3% 0039270 00392702 2/2   p containing nucleoside triphosphate hy 
 954::1185 6.5e-19 31.3% 0040678 00406782 2/2   p containing nucleoside triphosphate hy 
 966::1180 6.7e-19 32.0% 0040419 00404192 2/2   p containing nucleoside triphosphate hy 
 377::568  1.3e-18 37.2% 0046441 00464411 1/2   p containing nucleoside triphosphate hy 
 376::571  3.2e-18 25.9% 0043986 00439861 1/2   p containing nucleoside triphosphate hy 
 997::1187   4e-18 33.1% 0049881 00498812 2/2   p containing nucleoside triphosphate hy 
 996::1199 4.1e-18 28.1% 0051056 00510562 2/2   p containing nucleoside triphosphate hy 
 380::566  5.5e-18 22.5% 0051376 00513761 1/2   p containing nucleoside triphosphate hy 
 381::585    6e-18 26.1% 0048702 00487021 1/2   p containing nucleoside triphosphate hy 
 341::576  8.2e-18 29.9% 0039270 00392701 1/2   p containing nucleoside triphosphate hy 
 378::542    1e-17 27.6% 0051553 00515531 1/2   p containing nucleoside triphosphate hy 
 377::569  1.3e-17 28.8% 0049881 00498811 1/2   p containing nucleoside triphosphate hy 
 996::1160 1.9e-17 28.4% 0051553 00515532 2/2   p containing nucleoside triphosphate hy 
 376::597    2e-17 25.4% 0051056 00510561 1/2   p containing nucleoside triphosphate hy 
 339::549  2.1e-17 26.5% 0039472 00394721 1/2   p containing nucleoside triphosphate hy 
 379::586  3.2e-17 27.5% 0048963 00489631 1/2   p containing nucleoside triphosphate hy 
 984::1194 3.7e-17 32.8% 0051325 00513252 2/2   p containing nucleoside triphosphate hy 
 372::542  4.1e-17 35.5% 0050867 00508671 1/2   p containing nucleoside triphosphate hy 
 981::1195 8.2e-17 37.1% 0044438 00444382 2/2   p containing nucleoside triphosphate hy 
 995::1160 1.1e-16 36.9% 0050867 00508672 2/2   p containing nucleoside triphosphate hy 
 376::567  2.4e-16 30.1% 0046895 00468951 1/2   p containing nucleoside triphosphate hy 
 996::1190 3.1e-16 26.7% 0047073 00470732 2/2   p containing nucleoside triphosphate hy 
 993::1112 3.4e-16 33.3% 0042008 00420082 2/2   p containing nucleoside triphosphate hy 
 994::1185 5.7e-16 29.4% 0046895 00468952 2/2   p containing nucleoside triphosphate hy 
 373::547  8.5e-16 43.9% 0043218 00432181 1/2   p containing nucleoside triphosphate hy 
 376::567    9e-16 29.2% 0049853 00498531 1/2   p containing nucleoside triphosphate hy 
 996::1184 1.4e-15 29.6% 0048963 00489632 2/2   p containing nucleoside triphosphate hy 
 378::539  2.4e-15 24.7% 0051551 00515511 1/2   p containing nucleoside triphosphate hy 
 378::588  2.6e-15 29.8% 0053247 00532471 1/2   p containing nucleoside triphosphate hy 
 972::1192 3.3e-15 23.5% 0043986 00439862 2/2   p containing nucleoside triphosphate hy 
 369::546  3.7e-15 28.9% 0047701 00477011 1/2   p containing nucleoside triphosphate hy 
 342::548  4.1e-15 27.0% 0040237 00402371 1/2   p containing nucleoside triphosphate hy 
 924::1100 4.9e-15 25.0% 0049577 00495772 2/2   p containing nucleoside triphosphate hy 
 354::546    5e-15 27.4% 0035641 00356411 1/2   p containing nucleoside triphosphate hy 
 346::549  6.6e-15 30.9% 0043792 00437921 1/2   p containing nucleoside triphosphate hy 
 379::571  9.6e-15 29.7% 0040588 00405881 1/2   p containing nucleoside triphosphate hy 
 989::1140 1.2e-14 30.5% 0048025 00480252 2/2   p containing nucleoside triphosphate hy 
 996::1157 1.2e-14 27.2% 0051551 00515512 2/2   p containing nucleoside triphosphate hy 
 380::569  1.3e-14 30.3% 0048044 00480441 1/2   p containing nucleoside triphosphate hy 
 336::549  2.2e-14 25.8% 0043790 00437901 1/2   p containing nucleoside triphosphate hy 
 375::483  2.5e-14 33.0% 0042008 00420081 1/2   p containing nucleoside triphosphate hy 
 997::1189 2.9e-14 29.7% 0040588 00405882 2/2   p containing nucleoside triphosphate hy 
 342::549  3.3e-14 29.9% 0038674 00386741 1/2   p containing nucleoside triphosphate hy 
 974::1165 3.3e-14 26.3% 0035641 00356412 2/2   p containing nucleoside triphosphate hy 
 958::1166 3.9e-14 35.7% 0038674 00386742 2/2   p containing nucleoside triphosphate hy 
 981::1167 4.3e-14 31.2% 0039472 00394722 2/2   p containing nucleoside triphosphate hy 
 996::1198 4.4e-14 29.7% 0049853 00498532 2/2   p containing nucleoside triphosphate hy 
 984::1166   2e-13 32.8% 0040237 00402372 2/2   p containing nucleoside triphosphate hy 
 354::554  4.9e-13 32.6% 0042094 00420941 1/2   p containing nucleoside triphosphate hy 
 991::1165 5.1e-13 41.4% 0043218 00432182 2/2   p containing nucleoside triphosphate hy 
 357::554  5.6e-13 27.9% 0036729 00367291 1/2   p containing nucleoside triphosphate hy 
 371::574  6.3e-13 21.9% 0048025 00480251 1/2   p containing nucleoside triphosphate hy 
 377::581    2e-12 25.0% 0046162 00461621 1/2   p containing nucleoside triphosphate hy 
 997::1181 2.4e-12 27.4% 0048272 00482722 2/2   p containing nucleoside triphosphate hy 
 981::1167 3.2e-12 29.2% 0043792 00437922 2/2   p containing nucleoside triphosphate hy 
 991::1179 4.2e-12 26.4% 0051138 00511382 2/2   p containing nucleoside triphosphate hy 
 998::1199 4.4e-12 28.9% 0048044 00480442 2/2   p containing nucleoside triphosphate hy 
 352::554  5.2e-12 26.4% 0047394 00473941 1/2   p containing nucleoside triphosphate hy 
 975::1164 5.2e-12 24.2% 0047701 00477012 2/2   p containing nucleoside triphosphate hy 
 349::556  1.4e-11 22.1% 0052726 00527261 1/2   p containing nucleoside triphosphate hy 
 379::592  1.6e-11 28.0% 0048272 00482721 1/2   p containing nucleoside triphosphate hy 
 996::1177 1.8e-11 31.7% 0053247 00532472 2/2   p containing nucleoside triphosphate hy 
 373::561  1.9e-11 24.0% 0051138 00511381 1/2   p containing nucleoside triphosphate hy 
 338::547    2e-11 20.9% 0043012 00430121 1/2   p containing nucleoside triphosphate hy 
 373::582  2.3e-11 27.2% 0053315 00533151 1/2   p containing nucleoside triphosphate hy 
 969::1163 2.8e-11 33.3% 0042094 00420942 2/2   p containing nucleoside triphosphate hy 
 972::1172 2.8e-11 31.7% 0036729 00367292 2/2   p containing nucleoside triphosphate hy 
 997::1133 3.1e-11 31.7% 0049606 00496062 2/2   p containing nucleoside triphosphate hy 
 373::584  3.9e-11 24.1% 0049933 00499331 1/2   p containing nucleoside triphosphate hy 
 997::1181 6.1e-11 34.0% 0051535 00515352 2/2   p containing nucleoside triphosphate hy 
 375::584  6.2e-11 22.1% 0047291 00472911 1/2   p containing nucleoside triphosphate hy 
 997::1181 6.4e-11 33.1% 0047808 00478082 2/2   p containing nucleoside triphosphate hy 
 988::1167 9.1e-11 29.1% 0043790 00437902 2/2   p containing nucleoside triphosphate hy 
 379::572  1.1e-10 25.7% 0047808 00478081 1/2   p containing nucleoside triphosphate hy 
 375::561  1.6e-10 29.2% 0047839 00478391 1/2   p containing nucleoside triphosphate hy 
 991::1179 2.2e-10 29.0% 0053315 00533152 2/2   p containing nucleoside triphosphate hy 
 998::1151 2.6e-10 31.9% 0046916 00469162 2/2   p containing nucleoside triphosphate hy 
 375::588  3.1e-10 18.5% 0051604 00516041 1/2   p containing nucleoside triphosphate hy 
 996::1182 3.2e-10 28.8% 0046162 00461622 2/2   p containing nucleoside triphosphate hy 
 981::1147 3.5e-10 26.0% 0052726 00527262 2/2   p containing nucleoside triphosphate hy 
 995::1190 4.3e-10 25.5% 0048706 00487062 2/2   p containing nucleoside triphosphate hy 
 338::554  5.3e-10 23.6% 0052155 00521551 1/2   p containing nucleoside triphosphate hy 
 347::545  6.1e-10 24.1% 0041830 00418301 1/2   p containing nucleoside triphosphate hy 
 357::547  7.9e-10 27.3% 0041617 00416171 1/2   p containing nucleoside triphosphate hy 
 379::533  1.1e-09 25.5% 0050989 00509891 1/2   p containing nucleoside triphosphate hy 
 991::1181 1.2e-09 23.6% 0049933 00499332 2/2   p containing nucleoside triphosphate hy 
 379::578  1.4e-09 25.3% 0049606 00496061 1/2   p containing nucleoside triphosphate hy 
 380::591  1.5e-09 26.3% 0046916 00469161 1/2   p containing nucleoside triphosphate hy 
 379::589  2.1e-09 25.0% 0047607 00476071 1/2   p containing nucleoside triphosphate hy 
 981::1172 2.8e-09 28.1% 0047394 00473942 2/2   p containing nucleoside triphosphate hy 
 374::568  5.5e-09 24.8% 0048939 00489391 1/2   p containing nucleoside triphosphate hy 
 367::548  8.6e-09 29.9% 0041053 00410531 1/2   p containing nucleoside triphosphate hy 
 981::1163 1.3e-08 35.1% 0052155 00521552 2/2   p containing nucleoside triphosphate hy 
 996::1182 1.3e-08 29.5% 0047291 00472912 2/2   p containing nucleoside triphosphate hy 
 379::568  1.5e-08 28.8% 0051535 00515351 1/2   p containing nucleoside triphosphate hy 
 997::1150 1.6e-08 28.6% 0047607 00476072 2/2   p containing nucleoside triphosphate hy 
 997::1148 1.6e-08 36.9% 0047813 00478132 2/2   p containing nucleoside triphosphate hy 
 994::1179 2.2e-08 29.8% 0047839 00478392 2/2   p containing nucleoside triphosphate hy 
 975::1136 3.1e-08 30.8% 0041617 00416172 2/2   p containing nucleoside triphosphate hy 
 343::537  3.2e-08 23.0% 0048266 00482661 1/2   p containing nucleoside triphosphate hy 
 369::560  4.2e-08 23.5% 0049757 00497571 1/2   p containing nucleoside triphosphate hy 
 996::1179 7.9e-08 28.2% 0045785 00457852 2/2   p containing nucleoside triphosphate hy 
 372::516  1.2e-07 30.8% 0051769 00517691 1/2   p containing nucleoside triphosphate hy 
 348::554  1.3e-07 20.0% 0047665 00476651 1/2   p containing nucleoside triphosphate hy 
 378::516  1.3e-07 28.2% 0049317 00493171 1/2   p containing nucleoside triphosphate hy 
 379::589  1.3e-07 23.2% 0048050 00480501 1/2   p containing nucleoside triphosphate hy 
 350::401  1.4e-07 32.7% 0047127 00471271 1/2   p containing nucleoside triphosphate hy 
 952::1163 2.5e-07 29.7% 0041830 00418302 2/2   p containing nucleoside triphosphate hy 
 999::1151 3.4e-07 23.9% 0050989 00509892 2/2   p containing nucleoside triphosphate hy 
 996::1148 4.2e-07 31.4% 0047756 00477562 2/2   p containing nucleoside triphosphate hy 
 377::568  4.6e-07 25.3% 0045785 00457851 1/2   p containing nucleoside triphosphate hy 
 981::1163 4.8e-07 28.5% 0043012 00430122 2/2   p containing nucleoside triphosphate hy 
 997::1180 6.2e-07 25.4% 0051604 00516042 2/2   p containing nucleoside triphosphate hy 
 378::572  7.9e-07 26.2% 0048706 00487061 1/2   p containing nucleoside triphosphate hy 
 996::1141 8.5e-07 35.3% 0051958 00519582 2/2   p containing nucleoside triphosphate hy 
 996::1151 8.9e-07 23.7% 0047772 00477722 2/2   p containing nucleoside triphosphate hy 
 379::460  9.1e-07 28.0% 0047813 00478131 1/2   p containing nucleoside triphosphate hy 
 997::1151 1.1e-06 31.3% 0049317 00493172 2/2   p containing nucleoside triphosphate hy 
 377::572  1.2e-06 24.2% 0048689 00486891 1/2   p containing nucleoside triphosphate hy 
 995::1103 1.5e-06 29.3% 0051206 00512062 2/2   p containing nucleoside triphosphate hy 
 996::1132   2e-06 28.4% 0045788 00457882 2/2   p containing nucleoside triphosphate hy 
 350::410  2.1e-06 26.2% 0044125 00441251 1/2   p containing nucleoside triphosphate hy 
 985::1166 2.1e-06 27.1% 0041053 00410532 2/2   p containing nucleoside triphosphate hy 
 379::405  2.2e-06 37.0% 0047772 00477721 1/2   p containing nucleoside triphosphate hy 
 376::450  2.3e-06 26.8% 0049190 00491901 1/2   p containing nucleoside triphosphate hy 
 376::567  2.5e-06 25.3% 0048255 00482551 1/2   p containing nucleoside triphosphate hy 
 378::404  3.3e-06 44.4% 0045970 00459701 1/2   p containing nucleoside triphosphate hy 
 990::1134 4.7e-06 28.6% 0051769 00517692 2/2   p containing nucleoside triphosphate hy 
 378::514    5e-06 24.0% 0047933 00479331 1/2   p containing nucleoside triphosphate hy 
 372::417  6.2e-06 43.5% 0040984 00409841 1/2   p containing nucleoside triphosphate hy 
 997::1150 6.2e-06 27.9% 0049398 00493982 2/2   p containing nucleoside triphosphate hy 
 377::552    8e-06 26.7% 0051206 00512061 1/2   p containing nucleoside triphosphate hy 
 995::1068 1.1e-05 24.3% 0049190 00491902 2/2   p containing nucleoside triphosphate hy 
 379::449  1.2e-05 21.4% 0047756 00477561 1/2   p containing nucleoside triphosphate hy 
 994::1141 1.3e-05 34.3% 0048266 00482662 2/2   p containing nucleoside triphosphate hy 
 380::569  1.4e-05 37.3% 0051851 00518511 1/2   p containing nucleoside triphosphate hy 
 354::547  1.6e-05 25.2% 0047420 00474201 1/2   p containing nucleoside triphosphate hy 
 378::517  2.7e-05 34.2% 0051958 00519581 1/2   p containing nucleoside triphosphate hy 
 363::400  2.9e-05 31.6% 0041032 00410321 1/2   p containing nucleoside triphosphate hy 
 981::1012 3.4e-05 34.4% 0041032 00410322 2/2   p containing nucleoside triphosphate hy 
 997::1134 4.1e-05 31.8% 0048050 00480502 2/2   p containing nucleoside triphosphate hy 
 998::1195 4.2e-05 23.5% 0048692 00486922 2/2   p containing nucleoside triphosphate hy 
 997::1180 4.4e-05 28.2% 0048381 00483812 2/2   p containing nucleoside triphosphate hy 
 377::581  4.9e-05 27.0% 0045788 00457881 1/2   p containing nucleoside triphosphate hy 
 379::405  6.1e-05 37.0% 0049398 00493981 1/2   p containing nucleoside triphosphate hy 
 994::1179 6.4e-05 27.6% 0048939 00489392 2/2   p containing nucleoside triphosphate hy 
 994::1185 6.5e-05 27.8% 0048255 00482552 2/2   p containing nucleoside triphosphate hy 
 994::1149 8.6e-05 24.2% 0050356 00503562 2/2   p containing nucleoside triphosphate hy 
 974::1136 9.5e-05 23.1% 0049757 00497572 2/2   p containing nucleoside triphosphate hy 
 364::400  9.8e-05 40.5% 0037862 00378621 1/2   p containing nucleoside triphosphate hy 
 981::1172 0.00012 20.0% 0047665 00476652 2/2   p containing nucleoside triphosphate hy 
 998::1179 0.00013 26.1% 0048689 00486892 2/2   p containing nucleoside triphosphate hy 
 341::406  0.00019 24.6% 0046258 00462581 1/2   p containing nucleoside triphosphate hy 
 375::517  0.00023 26.6% 0040121 00401211 1/2   p containing nucleoside triphosphate hy 
 995::1151 0.00023 28.7% 0050194 00501942 2/2   p containing nucleoside triphosphate hy 
 378::535  0.00031 23.4% 0040315 00403151 1/2   p containing nucleoside triphosphate hy 
 380::405  0.00034 42.3% 0051580 00515801 1/2   p containing nucleoside triphosphate hy 
 997::1132 0.00041 27.6% 0047933 00479332 2/2   p containing nucleoside triphosphate hy 
 990::1165 0.00042 28.0% 0040984 00409842 2/2   p containing nucleoside triphosphate hy 
 379::562  0.00055 25.4% 0048381 00483811 1/2   p containing nucleoside triphosphate hy 
 378::545  0.00067 29.3% 0050356 00503561 1/2   p containing nucleoside triphosphate hy 
 354::548  0.00074 25.6% 0049491 00494911 1/2   p containing nucleoside triphosphate hy 
 377::405  0.00081 38.5% 0050194 00501941 1/2   p containing nucleoside triphosphate hy 
 380::405  0.00091 38.5% 0048692 00486921 1/2   p containing nucleoside triphosphate hy 
 377::405    0.001 38.5% 0046459 00464591 1/2   p containing nucleoside triphosphate hy 
 990::1030  0.0012 47.4% 0034832 00348322 2/2   p containing nucleoside triphosphate hy 
 367::410   0.0015 34.1% 0045376 00453761 1/2   p containing nucleoside triphosphate hy 
 981::1165  0.0016 23.5% 0047420 00474202 2/2   p containing nucleoside triphosphate hy 
 380::405   0.0017 38.5% 0049306 00493061 1/2   p containing nucleoside triphosphate hy 
1000::1163  0.0018 31.2% 0046258 00462582 2/2   p containing nucleoside triphosphate hy 
 377::405   0.0021 46.4% 0046442 00464421 1/2   p containing nucleoside triphosphate hy 
 985::1028  0.0021 27.3% 0045376 00453762 2/2   p containing nucleoside triphosphate hy 
 365::397   0.0023 42.4% 0048819 00488191 1/2   p containing nucleoside triphosphate hy 
 364::401   0.0031 28.9% 0038732 00387321 1/2   p containing nucleoside triphosphate hy 
 998::1179  0.0031 28.1% 0051580 00515802 2/2   p containing nucleoside triphosphate hy 
 997::1019   0.004 56.5% 0045970 00459702 2/2   p containing nucleoside triphosphate hy 
 339::406   0.0045 26.5% 0049053 00490531 1/2   p containing nucleoside triphosphate hy 
 370::401   0.0049 34.4% 0041400 00414001 1/2   p containing nucleoside triphosphate hy 
 970::1012  0.0053 32.6% 0047127 00471272 2/2   p containing nucleoside triphosphate hy 
 995::1102  0.0062 26.8% 0046459 00464592 2/2   p containing nucleoside triphosphate hy 
 984::1012   0.007 34.5% 0047503 00475032 2/2   arboxykinase-like                       
 376::398   0.0079 50.0% 0049506 00495061 1/2   p containing nucleoside triphosphate hy 
 324::544   0.0094 18.8% 0038151 00381511 1/2   p containing nucleoside triphosphate hy 
 972::1032  0.0097 31.7% 0044125 00441252 2/2   p containing nucleoside triphosphate hy 
 997::1123   0.012 22.2% 0046913 00469132 2/2   p containing nucleoside triphosphate hy 
 375::401    0.013 33.3% 0044482 00444821 1/2   p containing nucleoside triphosphate hy 
 982::1012   0.013 38.7% 0037862 00378622 2/2   p containing nucleoside triphosphate hy 
 372::545    0.014 25.8% 0034832 00348321 1/2   p containing nucleoside triphosphate hy 
 339::441    0.015 21.5% 0040238 00402381 1/2   p containing nucleoside triphosphate hy 
 377::404    0.015 42.9% 0050317 00503171 1/2   p containing nucleoside triphosphate hy 
 378::401    0.019 37.5% 0044740 00447401 1/2   p containing nucleoside triphosphate hy 
 368::397    0.022 41.4% 0047023 00470231 1/2   p containing nucleoside triphosphate hy 
 973::1012   0.023 20.5% 0047023 00470232 2/2   p containing nucleoside triphosphate hy 
 997::1123   0.026 22.8% 0038794 00387942 2/2   p containing nucleoside triphosphate hy 
 379::483     0.03 23.1% 0046913 00469131 1/2   p containing nucleoside triphosphate hy 
 981::1019    0.03 35.9% 0049491 00494912 2/2   p containing nucleoside triphosphate hy 
 998::1019   0.061 59.1% 0051851 00518512 2/2   p containing nucleoside triphosphate hy 
 380::401    0.063 50.0% 0046315 00463151 1/2   p containing nucleoside triphosphate hy 
 994::1021   0.064 42.9% 0049506 00495062 2/2   p containing nucleoside triphosphate hy 
 997::1029   0.067 36.4% 0038163 00381632 2/2   p containing nucleoside triphosphate hy 
 379::427    0.075 32.7% 0038794 00387941 1/2   p containing nucleoside triphosphate hy 
 378::560    0.079 23.4% 0051942 00519421 1/2   p containing nucleoside triphosphate hy 
 991::1030   0.088 35.0% 0051331 00513312 2/2   p containing nucleoside triphosphate hy 
 996::1178   0.092 24.2% 0051942 00519422 2/2   p containing nucleoside triphosphate hy 
 981::1020    0.11 35.0% 0040238 00402382 2/2   p containing nucleoside triphosphate hy 
 998::1019    0.13 45.5% 0049306 00493062 2/2   p containing nucleoside triphosphate hy 
 984::1039    0.26 27.8% 0049053 00490532 2/2   p containing nucleoside triphosphate hy 
 995::1019    0.31 44.0% 0046442 00464422 2/2   p containing nucleoside triphosphate hy 
 995::1022    0.31 39.3% 0050317 00503172 2/2   p containing nucleoside triphosphate hy 
 982::1012    0.39 29.0% 0038732 00387322 2/2   p containing nucleoside triphosphate hy 
 998::1016    0.39 57.9% 0046315 00463152 2/2   p containing nucleoside triphosphate hy 
 379::412     0.48 32.4% 0038163 00381631 1/2   p containing nucleoside triphosphate hy 
 984::1012    0.51 37.9% 0048819 00488192 2/2   p containing nucleoside triphosphate hy 
 993::1150    0.59 26.8% 0038151 00381512 2/2   p containing nucleoside triphosphate hy 
 996::1012    0.73 52.9% 0040315 00403152 2/2   p containing nucleoside triphosphate hy 
 373::412     0.92 35.0% 0051331 00513311 1/2   p containing nucleoside triphosphate hy 
 993::1135    0.92 26.6% 0040121 00401212 2/2   p containing nucleoside triphosphate hy 
 996::1012     1.3 47.1% 0044740 00447402 2/2   p containing nucleoside triphosphate hy 
 375::402      1.7 35.7% 0047503 00475031 1/2   arboxykinase-like                       
 988::1012     3.5 24.0% 0041400 00414002 2/2   p containing nucleoside triphosphate hy 
 993::1012     4.1 35.0% 0044482 00444822 2/2   p containing nucleoside triphosphate hy 
   1::1228


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKESKGRKPGALSRCLRFAGRRKPLVFASMALAVLSAAASFVPYVAIYFMIRDAVGVYPNLAAVDVSAM
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00422811   1/2  ekee....kr.....llrylkpykkllllalllallaallslllplllgrlidall.....pgg.dlsll
00448932   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00530601   1/2  --ep.k........Rllrylkpykkllllalllsllaallslllplllgqlidalll.....gg.dlsdp
00496111   1/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00503562   2/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00503561   1/2  ----------------------------------------------------------------------
00494911   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00490531   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00475032   2/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00469132   2/2  ----------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00469131   1/2  ----------------------------------------------------------------------
00494912   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00381632   2/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00519421   1/2  ----------------------------------------------------------------------
00513312   2/2  ----------------------------------------------------------------------
00519422   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00490532   2/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00381631   1/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00513311   1/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00475031   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TGYAGLAVAGIVVDVGCYLAALLCSHAAAFDAQYRTKLDIAAHLGRIPLGHIARLGTGRISKVMDESVGG
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00422811   1/2  lllallllllallrallsylrsyllarlgqrllarlrsrlfrkllrlplsffdktstGdllsrltnDvea
00448932   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00530601   1/2  llllstlllllllllllallrallsylrsyllarlgqrlsarlrlrlfrkllrlplsffdktstGdllsr
00496111   1/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00503562   2/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00503561   1/2  ----------------------------------------------------------------------
00494911   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00490531   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00475032   2/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00469132   2/2  ----------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00469131   1/2  ----------------------------------------------------------------------
00494912   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00381632   2/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00519421   1/2  ----------------------------------------------------------------------
00513312   2/2  ----------------------------------------------------------------------
00519422   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00490532   2/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00381631   1/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00513311   1/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00475031   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           IEQFIGHSIPDLAATAAAPVVLAALLFVFDWRFGVATLAAVAVACVVQFSGYADKRVMASMGRYQEVKEQ
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00422811   1/2  idellssllltllralltllgalivlfylswrlalvlllllpllllltl..lfgkrlrklsrlvqealse
00448932   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00530601   1/2  ltnDveaidellssllltlllalltligalivlfliswklalvlllllpl..lllltllfgkrlrklsrl
00496111   1/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00503562   2/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00503561   1/2  ----------------------------------------------------------------------
00494911   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00490531   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00475032   2/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00469132   2/2  ----------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00469131   1/2  ----------------------------------------------------------------------
00494912   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00381632   2/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00519421   1/2  ----------------------------------------------------------------------
00513312   2/2  ----------------------------------------------------------------------
00519422   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00490532   2/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00381631   1/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00513311   1/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00475031   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           MGNASVEYVRGMRVVKAFGQTARSFKRLSDAIKDYTGLSLDVTLFFRNSMPGFTAVLNNAYLFVLPVGIL
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00422811   1/2  lnsvlveslsgirtvkafgaeerelerfeealdelrkaslklarlsallspllqllsalalalvlllgal
00448932   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00530601   1/2  aqealselnsllveslsgirtvkafgaeerelerfdealdellkaslklarlsallspllellsalalal
00496111   1/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00503562   2/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00503561   1/2  ----------------------------------------------------------------------
00494911   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00490531   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00475032   2/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00469132   2/2  ----------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00469131   1/2  ----------------------------------------------------------------------
00494912   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00381632   2/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00519421   1/2  ----------------------------------------------------------------------
00513312   2/2  ----------------------------------------------------------------------
00519422   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00490532   2/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00381631   1/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00513311   1/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00475031   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LAPGAQDWPTFVLSLVFYLLFVHSISSVFTKILYVSEDGMLAQANIDRIDSVLGIEELSCPEAPKAPKDA
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  --------------------------------------------------llllllallllllllllldp
00379582   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00530591   1/2  -------------------------------------------------------llllllaleelpllg
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00424961   1/2  ------------------------------------------------------lgepldglgplrpapg
00502742   2/2  ----------------------------------------------------------------------
00475991   1/2  -----------------------------------------------------------lllaaelpelg
00420702   2/2  ----------------------------------------------------------------------
00440861   1/2  -------------------------------------------------------------Mpllslgep
00482261   1/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00475891   1/2  -------------------------------------------------------------------lll
00509431   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00466971   1/2  --------------------------------------------------------------------ll
00379602   2/2  ----------------------------------------------------------------------
00500441   1/2  -------------------------------------------------------------------lll
00404101   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00436511   1/2  ------------------------------------ievpvglallgrvldllgepid..gkgplelgep
00379601   1/2  ---------------llllpllllpdeplaaldvalqralvslerllellvdpgasdihinpggpvrvri
00361211   1/2  --------------------------------------------------------------plellgep
00436512   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00469451   1/2  ---------------------------------------------------------------------a
00468602   2/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00422811   1/2  lvlngeltvgdlvafllyalqllgplsqlgsllsel....qrarvaaeRi............D.------
00448932   2/2  ----------------------------------------------------------------------
00488521   1/2  -------------------------------------------------------------lllllalel
00498251   1/2  ----------------------------------------------------------------------
00368501   1/2  -----------------------------------------------------------------kerll
00367481   1/2  ------------------------------------------------------------yvrPelldep
00367482   2/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00372301   1/2  ------------------------------------------------------------yvlPllsdgm
00530602   2/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00371631   1/2  ---------------------------mseliiylelselewallradvgltlteaelkrlkgl....nd
00368502   2/2  ----------------------------------------------------------------------
00530601   1/2  vlllgaylvlngelt...vgdlvafllyalrllgplrqlgsllselqralaaaerifelld.PE------
00496111   1/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------esalel
00381442   2/2  ----------------------------------------------------------------------
00500611   1/2  -------------------------------------------------------------------pgl
00532531   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00495031   1/2  --------------------------------------------------------------------ls
00381441   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00437941   1/2  ------------------------------------------------------------------lrpl
00462761   1/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00379261   1/2  ------------------------------------------------------------------drll
00475382   2/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00444381   1/2  ---------------------------------------------------------------asdelek
00387201   1/2  ----------------------------------------------------------------mssgep
00368572   2/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00368571   1/2  ------------------------------------------------llgvrllpplppklagllplag
00493431   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00404191   1/2  -----------------------------------------------------------------vellp
00493432   2/2  ----------------------------------------------------------------------
00495771   1/2  -----------------------------------nellrpivanvdlvlivvdardplfslnlllrylv
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00406781   1/2  ---------------------------------------------------------------plveklr
00464412   2/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00392701   1/2  ------------------------------------------------------------eklrpvlldd
00515531   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------lvslleslelpl
00489631   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00402371   1/2  -------------------------------------------------------------vlektgipl
00495772   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00437921   1/2  -----------------------------------------------------------------lglll
00405881   1/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00437901   1/2  -------------------------------------------------------slllvekyrpvlldd
00420081   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00386741   1/2  -------------------------------------------------------------klrpvlldd
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00527261   1/2  --------------------------------------------------------------------np
00482721   1/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00430121   1/2  ---------------------------------------------------------iPvsklleddrpl
00533151   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00521551   1/2  ---------------------------------------------------------plveklrpvlldd
00418301   1/2  ------------------------------------------------------------------drpl
00416171   1/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00482661   1/2  --------------------------------------------------------------kkvaivll
00497571   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00476651   1/2  -------------------------------------------------------------------yep
00493171   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00471271   1/2  ---------------------------------------------------------------------p
00418302   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00441251   1/2  ---------------------------------------------------------------------r
00410532   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00503562   2/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00462581   1/2  ------------------------------------------------------------edleslllnp
00401211   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00503561   1/2  ----------------------------------------------------------------------
00494911   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00490531   1/2  ----------------------------------------------------------tlpaleseardl
00414001   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00475032   2/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00381511   1/2  -------------------------------------------lllillelllalarllleellldllkl
00441252   2/2  ----------------------------------------------------------------------
00469132   2/2  ----------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------Plsklleddlpl
00503171   1/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00469131   1/2  ----------------------------------------------------------------------
00494912   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00381632   2/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00519421   1/2  ----------------------------------------------------------------------
00513312   2/2  ----------------------------------------------------------------------
00519422   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00490532   2/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00381631   1/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00513311   1/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00475031   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SVSLRDVTFSYEDDAEPALRNVSLEIPAGTVCAVVGPSGSGKSTLANLVARFWDVDSGQVLVGGVDVREM
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  llelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgldilal
00379582   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00379581   1/2  -lepllevenlsksy..ggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgld
00530591   1/2  elllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkditdl
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  llllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00482262   2/2  ----------------------------------------------------------------------
00510251   1/2  -lllllllllaeellelleeeelllllllllllllgdpllelenlsksy..ggvpalkdvsltikpGeiv
00458602   2/2  ----------------------------------------------------------------------
00490801   1/2  -llllllllalllelleeeeellllllalllllgdpllelenlsksy..ggvpalkdvsltikpGeival
00378982   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00367901   1/2  -lelknlslsyg...ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidli
00424961   1/2  llelenvsksygtg..ialidlslpigkGervalvGpsGaGKttLlrliaglldpdsgeilldgvdiger
00502742   2/2  ----------------------------------------------------------------------
00475991   1/2  elllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdildl
00420702   2/2  ----------------------------------------------------------------------
00440861   1/2  llelenlsksy..ggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKStLlnaLl
00482261   1/2  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdildl
00424962   2/2  ----------------------------------------------------------------------
00475891   1/2  elllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00509431   1/2  -Mlelknlslsnfr....vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllraggls
00390411   1/2  ---Mknlslrygn..fralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgklsdlirr
00378981   1/2  -lpllelenlsksy..ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldl
00425572   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00420701   1/2  -lpllelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgldl
00500442   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00458601   1/2  ---lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdit
00502741   1/2  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00466971   1/2  alllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00379602   2/2  ----------------------------------------------------------------------
00500441   1/2  elllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsGeilldgkdildl
00404101   1/2  --elenlsksygg..vlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgldltal
00425571   1/2  -lelenlsksy..ggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllal
00466932   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00436511   1/2  llevenlsksyggrklvlepletgialddvsltikkGervglvGpsGaGKtTLlkllagllkpdsGeilv
00379601   1/2  dgvlelllvvldllsldleellalasriavlagrdiserrlpldgallpdgsrvrvrlsplptllggesl
00361211   1/2  llelenlsksyg..gitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvlldgleisa
00436512   2/2  ----------------------------------------------------------------------
00466931   1/2  --------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeilldgkdi
00468691   1/2  -lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksygtg..ialidvsltigr
00468692   2/2  ----------------------------------------------------------------------
00485451   1/2  -------skiygd...ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpllltggk
00436071   1/2  -pllelenlsksygg...lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldll
00468601   1/2  --------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyra
00485452   2/2  ----------------------------------------------------------------------
00448931   1/2  ------------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarl
00469451   1/2  llelenlskiy.ggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgkdv
00468602   2/2  ----------------------------------------------------------------------
00485931   1/2  -----------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi...
00469452   2/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  --------------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdl
00498252   2/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00422141   1/2  -dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlielifld
00485932   2/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00488521   1/2  llevenlrist..gikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGei........
00498251   1/2  vekllglalllieklflkvlprllsllelenlskiytg..ipal.dvslglgGlppGeivlllGpsGsGK
00368501   1/2  llelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGppGvGKTtlaralakll.
00367481   1/2  llelengrhPllsksyg..gkvvlndislsip.gellvitGPngsGKSTllralaglllpasggilvpge
00367482   2/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00372301   1/2  pllelenlrkpy..ggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpasggilvdgedlr.
00530602   2/2  ----------------------------------------------------------------------
00475371   1/2  -----------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDirrp
00437981   1/2  -lveklrpknldkvi..gqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilld
00371631   1/2  lleledlskiygplsrlikllleellrllgklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllap
00368502   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00496111   1/2  ---elenltklytg..ikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliiglel
00496112   2/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00503371   1/2  -----------------Mmlkslelknfkslkdvsligdfspg.ltaivGpNGsGKStlldaiagllgpd
00495371   1/2  lleledltklstg..ikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp...evlvdgldl
00381442   2/2  ----------------------------------------------------------------------
00500611   1/2  lsllelllelenltklptg..ipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapdsgeill
00532531   1/2  ---------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinle
00464792   2/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00464791   1/2  -lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgi..vlidvslpigk
00495031   1/2  alellleledltkistg..ipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglgliplggk
00381441   1/2  ----------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprl
00414121   1/2  --------------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeili
00437941   1/2  veklrpknlddvygqeevlkalslalekgrpehlllvGppGtGKTtlakalaglllptsggvrvlgidas
00462761   1/2  ------------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddl
00478412   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00451571   1/2  -----------------------MsikkgeiiaivGppGsGKsTlaklLakll....glivldgddl...
00451572   2/2  ----------------------------------------------------------------------
00475381   1/2  --------------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlavl
00490731   1/2  --------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpyrp
00480471   1/2  ----------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilgei
00379261   1/2  leelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlaralAkllg
00475382   2/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00379961   1/2  ---yrpvdfddivGqeealralslalaagppegvllvGppGtGKstlaralagllppdsgrivlvgnlsd
00475521   1/2  ---------------evlalhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvdg.dlv.
00484101   1/2  ---------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldigrl
00490732   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00489571   1/2  ----rvknlsksyggk..talddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt............
00478411   1/2  --------------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.....Gtilldg.dlvr
00475522   2/2  ----------------------------------------------------------------------
00457311   1/2  --------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddly
00470731   1/2  ----------------------arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTl
00444381   1/2  llelrpvlledvigqeeakkalslalelplkrlelfgklddligrspairrllellgarpgenvlLvGpp
00387201   1/2  llevenlskry..ggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftlvrey
00368572   2/2  ----------------------------------------------------------------------
00503741   1/2  ---fifldlrplallplpdrlvgrdeeiealskalgg....aldgvslsiepggivllvGppGvGKTtLa
00387202   2/2  ----------------------------------------------------------------------
00368571   1/2  ladgdglgvllGkll....dgvpvtldlgelgrhllivGptGsGKStllrllaglllpdggrviviDpkg
00493431   1/2  ---------------------------kGelivllGpsGaGKsTllkllagllgptsgvisvggttrepr
00512891   1/2  -----------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdv...
00477972   2/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------GkgelivllGpsGsGKsTlarlLagll...ggsvldtgepir
00478442   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00513251   1/2  ---------------iellsdlslsipspevvllvGppGsGKstlakklaell....gfilidaddlr..
00513762   2/2  ----------------------------------------------------------------------
00404191   1/2  kvtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlakalanelkkrggrvlyvsa...
00493432   2/2  ----------------------------------------------------------------------
00495771   1/2  laeaagippvlvlnKiDlleeeedlelleellkelesi.gvdvvlvsakkgalldilldilkgktvalvG
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepig
00434401   1/2  ------lsksygg..llalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyr
00499191   1/2  ----------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd........
00477971   1/2  --------------------------hkgelvvlvGPsGaGKsTLlnaLlgllp.tsgvisvsgttr.pp
00406781   1/2  pvllddvigqeeakeallealaglrlllkdlslgippgknvllvGppGtGKTtlakalagelgvpfvris
00464412   2/2  ----------------------------------------------------------------------
00478441   1/2  --------------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.....Gailvdd.dlvl
00487022   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464411   1/2  --------------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsg
00439861   1/2  -------------------------kleeveristgipeldellgGglpkgslilitGppGsGKTtlalq
00498812   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00513761   1/2  -----------------------------kiiaivGkgGsGKTTllnklaglla.dggkvlvidlDpa..
00487021   1/2  ------------------------------rmkiivltGpsGsGKsTlarlLaell....gvvvidtddl
00392701   1/2  vvgqeeakeallealagarlaledlslgirpgknvlLvGppGvGKTtlaralagllgapfgrvdasd...
00515531   1/2  ---------------------------kgekvallGlsgsGKSTllnrllglefaygpTigptsgtieid
00498811   1/2  --------------------------kP.gkiigltGpsGsGKsTlarlLae.l....gvividgddltr
00515532   2/2  ----------------------------------------------------------------------
00510561   1/2  -------------------------ldglgepldgllpilaklfrpievlalgllerksverlstGikaL
00394721   1/2  leklrpvllddvvgreealeallealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpvv
00489631   1/2  ----------------------------MkgklillvGppGsGKtTlaraLaellglpf..iridgddll
00513252   2/2  ----------------------------------------------------------------------
00508671   1/2  ---------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgsg
00444382   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00468951   1/2  -------------------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgi
00470732   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlg
00498531   1/2  -------------------------ldklgkildlalkileksflklevlalgvlerkeverlstGikaL
00489632   2/2  ----------------------------------------------------------------------
00515511   1/2  ---------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegtieid
00532471   1/2  ---------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvg
00439862   2/2  ----------------------------------------------------------------------
00477011   1/2  ------------------eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpv
00402371   1/2  tkllrpvllddviGqeealeallealrrrpgrnvllvGppGvGKTtlaralagllvrssgpilldgvpfv
00495772   2/2  ----------------------------------------------------------------------
00356411   1/2  ---lknlsksyg..ilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtieidgv
00437921   1/2  veklrpkllddvvgqeealerlllalkagklphlllvGppGvGKTtlaralarlllgsgggvdvieldas
00405881   1/2  ----------------------------gervglvGrpgaGKSTLlnaltglkaivsgypgttldpnlgv
00480252   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00480441   1/2  -----------------------------rlivllGpsGaGKsTlaklLaellp..glivisvgdttrep
00437901   1/2  vvgqeeakeallealalararplkrpelflslgirpgrillLyGppGvGKTtlakalakel.........
00420081   1/2  ------------------------smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllvgEPiayw
00405882   2/2  ----------------------------------------------------------------------
00386741   1/2  vvgqeeak....eallealkavllgirpgehllLvGppGtGKTtlaralagelga...............
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00420941   1/2  ---lrpvllddvigqeeakeallealalplkrldlglslgirpgkgvllyGppGtGKTtlakalagel..
00432182   2/2  ----------------------------------------------------------------------
00367291   1/2  ------vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanel..
00480251   1/2  --------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDpyr
00461621   1/2  --------------------------mkgmiialtGppGsGKsTlaklLaerlglpfistddly......
00482722   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00473941   1/2  -eklrpvllddvvgqeevkkalllalalallrgepgehvlLvGppGtGKTtlaralagllga........
00477012   2/2  ----------------------------------------------------------------------
00527261   1/2  filgpkvdledfigreeelkeleeal..pkivlltGprGsGKTtllkalakel..gkpviyidlselssk
00482721   1/2  ----------------------------kgkiigltGpsGsGKsTlarlLae.l...glpvidtddlyre
00532472   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilvkdaidtr
00430121   1/2  leklrpvlfddvvgqeeakeallealrrgrkglelgirpggnvllvGPpGvGKTtlakalagllfp....
00533151   1/2  ----------------------MsldikkgklivltGppGsGKtTlarlLaerlglpfistddllrelvp
00420942   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------PslslkkgklivltGppGsGKtTlakaLaerl....glpfidtddllr
00515352   2/2  ----------------------------------------------------------------------
00472911   1/2  ------------------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrglag
00478082   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------gkvivltGppGsGKtTlarlLaellkplgggvvvidtddlrr
00478391   1/2  ------------------------msikkgklilltGppGsGKtTlaralaerl...glpvidgddllre
00533152   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00516041   1/2  ------------------------mlk.gklillvGppGsGKtTlaralaeelglpfvvidaddl....l
00461622   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00521551   1/2  vigqeeakeallealarlkapelflslglrpgkgvlLvGppGtGKTtlaralagllgapfvrlsas....
00418301   1/2  leklrpvllddviGqeeakkallealalplkrlelfeklrgirpgknvlLvGppGtGKTtlaralakll.
00416171   1/2  ------diigqeeakkallealslaartgenvllvGppGtGKttlaralakllprsgvpfvrvncsalte
00509891   1/2  ----------------------------pkvigitGpsGsGKTTlanaLarllkarglkvavidrdpgrl
00499332   2/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------gklivltGppGsGKtTlaklLaerl....glpvistddllre
00469161   1/2  -----------------------------llIvieGppGsGKsTlaklLaerlgltglsvlltredgfgt
00476071   1/2  ----------------------------kgkiigltGpsGsGKsTlaklLaelglpvidtddltregvll
00473942   2/2  ----------------------------------------------------------------------
00489391   1/2  -----------------------lsikkgklivltGppGsGKtTlakaLaerl....glpv...istddl
00410531   1/2  ----------------gelknlslelkkglkillvGlngvGKTtllkrlag...................
00521552   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------mngklivltGppGsGKtTlaraLaerl....glpv...istd
00476072   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00482661   1/2  snyalsislddlllildlykevqvaydnfykvdesdiayqyallakedenaaaflksnrqkklvrdladr
00497571   1/2  ------------------aselvqwlldlgildeseilledlenalalllsligaklvkdllllvlkylp
00457852   2/2  ----------------------------------------------------------------------
00517691   1/2  ---------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg......
00476651   1/2  lveklrpvllddlvgqeeakeallealaggrpprpvllvGppGtGKTtlaralanelgrpfvpvallcfv
00493171   1/2  ---------------------------mgklivllGpsGaGKsTlaklLaekl...glivlsvgdttrep
00480501   1/2  ----------------------------MgklillvGppGsGKtTlaralaell..g.gvvvidgddlrr
00471271   1/2  railelesliksllekllellkrlslklkkglkvalvGrpgvGKStLlnal-------------------
00418302   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457851   1/2  --------------------------PkgklivltGppGsGKtTlakaLaerl...glpvistddllrea
00430122   2/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00487061   1/2  ---------------------------ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvviyep
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------kgkvivltGppGsGKtTlarlLaellkplglgvvvidgddlr
00493172   2/2  ----------------------------------------------------------------------
00486891   1/2  --------------------------m...livltGppGsGKtTlakaLaerl...glpvidtddllrel
00512062   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00441251   1/2  emsmsewilerldklledidwnpivkllkyqgvefigflealknilkgipkknclllyGP----------
00410532   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------kpklilltGppGsGKttlaraLaeelg---------------
00491901   1/2  -------------------------lmkgkiilltGppGsGKttlakaLaeel....glpfidtddllre
00482551   1/2  -------------------------everlstgipalDellgGglppgslvliaGppGsGKTtlalqlaa
00459701   1/2  ---------------------------MpkvillvGppGsGKTTlakaLakrlg----------------
00517692   2/2  ----------------------------------------------------------------------
00479331   1/2  ---------------------------apkli.ltGppGsGKttlakaLaeel....glpf...idtddl
00409841   1/2  ---------------------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdp---
00493982   2/2  ----------------------------------------------------------------------
00512061   1/2  --------------------------kkkkgklivltGppGsGKtTlakaLaerl..g.glvvidtddll
00491902   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------kkpkvillvGppGsGKtTlaraLakrlaelgkgvvvidtddl
00482662   2/2  ----------------------------------------------------------------------
00518511   1/2  -----------------------------klIvleGpsGsGKsTlaklLaekl....glpf...idtddl
00474201   1/2  ---deelelleklslllveklrpvllddlvgqeeakeallealragrpghvllvGppGtGKTtlaralan
00519581   1/2  ---------------------------kpkvilltGppGvGKttlarlLakllglpliidldalaell..
00410321   1/2  ------------yggllllkdlslelkkglkilllGlngaGKTTllnrll--------------------
00410322   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00457881   1/2  --------------------------m.gklivltGppGsGKtTlaklLaerl...glpvidtddllrel
00493981   1/2  ----------------------------kpklilltGppGsGKttlaraLaeelg---------------
00489392   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00503562   2/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00378621   1/2  -------------glklllrrlslllkkglkvllvGlpgvGKstllnrla--------------------
00476652   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00462581   1/2  lvkfedivpkvlddleealealaea.klpppkgvllyGppGtGKTtlaralakelg--------------
00401211   1/2  ------------------------elkrglnvgivGhvgaGKSTLlnaLlgll.................
00501942   2/2  ----------------------------------------------------------------------
00403151   1/2  ---------------------------kglkivlvGdsgvGKTtLlnrllgdefpvsyiptigvdfyvkt
00515801   1/2  -----------------------------llIvltGppGsGKtTlaklLaerlgl---------------
00479332   2/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------PkvillsGpPGvGKTtlaaaLakyLksqgldvlvldldellr
00503561   1/2  ---------------------------kPydrLldivgigfltaddialalgiagdsperlllalallse
00494911   1/2  ---llveklrpvllddlvgqeeakeallealaagrpghvllvGppGtGKTtlaralanellrlgvl....
00501941   1/2  --------------------------k...lilltGppGsGKttlaralaeelgl---------------
00486921   1/2  -----------------------------mlivltGppGsGKtTlakaLaerlgl---------------
00464591   1/2  --------------------------k...livltGppGsGKtTlakaLaerlgl---------------
00348322   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------vwvpdeeeglvlalvlsdgslllvkldlllllnplkllgveDla----------
00474202   2/2  ----------------------------------------------------------------------
00493061   1/2  -----------------------------mlIvltGppGsGKtTlakaLaerlgl---------------
00462582   2/2  ----------------------------------------------------------------------
00464421   1/2  --------------------------MkkgkfIvieGpdGsGKTTlaklLae.le---------------
00453762   2/2  ----------------------------------------------------------------------
00488191   1/2  --------------fllsllrrlslllkrllkvalvGlpgvGKStLl-----------------------
00387321   1/2  -------------glkglllrlklelkkllkillvGlpgvGKTtllnrllg-------------------
00515802   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00490531   1/2  tekarpvllddviGqeeaierllealergppgnvLlvGppGtGKTtlaralakela--------------
00414001   1/2  -------------------rrlllelkmllrvgivGlpNvGKSTLfnaLtg-------------------
00471272   2/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00475032   2/2  ----------------------------------------------------------------------
00495061   1/2  -------------------------dlgllliyeevllydvvprgrli----------------------
00381511   1/2  dlilpeesfeelgldpellealkkgffeltpiQkeaipailkgrdlllvapTGsGKTlaallpalelllk
00441252   2/2  ----------------------------------------------------------------------
00469132   2/2  ----------------------------------------------------------------------
00444821   1/2  ------------------------elkkllkvllvGlpgvGKttllnrllg-------------------
00378622   2/2  ----------------------------------------------------------------------
00348321   1/2  ---------------------ilealrsgrvvllvgptGsGKTtlalalalel.................
00402381   1/2  llklrpdlfddvvgqdeaieallealrrarkglnlglkprgnvlLvGppGtGKTtlaralakal......
00503171   1/2  --------------------------psgrlivltGPsGsGKsltdtlskaLle----------------
00447401   1/2  ---------------------------kelkivlvGdsgvGKttLlnrllg-------------------
00470231   1/2  -----------------elaellsllierlllrdlllelkll.kvll-----------------------
00470232   2/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00469131   1/2  ----------------------------mmkviavtsgkgGvGKTtlaanlaaalaerGkrVllvdlDlp
00494912   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00463151   1/2  -----------------------------MkiIgltGpiGsGKsTvaklLa-------------------
00495062   2/2  ----------------------------------------------------------------------
00381632   2/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------mkviavtsgkgGvGKTtlaanLaaalaerGkkVllidaDpqg
00519421   1/2  ---------------------------pgglvlitGpmgsGKTtlllrllkrleeagkkvlvf.....kp
00513312   2/2  ----------------------------------------------------------------------
00519422   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00490532   2/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00381631   1/2  ----------------------------grdvllaapTGsGKTlaallpilllllrgkrvlv--------
00488192   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00513311   1/2  ----------------------elalesgrdvllvaptGsGKTlaallpilellllrggrvl--------
00401212   2/2  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00475031   1/2  ------------------------vgkkgdvalffGlSGtGKTtlsadphrl------------------
00414002   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           GQDELMGSLSLVFQDSHLFRESVAENIRRGRPGATDDEVVEAAKAAQADAFINGLPHGYATVIGSEGVHL
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  slaelrrrigyvfqdpalfpltvrenlalglllallllglskaeararalellellplgldtlldrlvge
00379582   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00379581   1/2  italslaelrrrgigyvfqdpalfpgltvrenlalglllllllllllllllllalskaearervlellel
00530591   1/2  slkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgletlldrlpseL
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  slkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgletlldrlpseL
00482262   2/2  ----------------------------------------------------------------------
00510251   1/2  alvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll........
00458602   2/2  ----------------------------------------------------------------------
00490801   1/2  vGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll..........
00378982   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00367901   1/2  lkgllllprstvatvelifdllgllliirrlilrdgsgeilidgkdislldlrelrrligyvpqdpalfp
00424961   1/2  srevtelleelrrviglvfqdpplfprltvaenialgaeyf....rdegadvllladsllrlagalrevl
00502742   2/2  ----------------------------------------------------------------------
00475991   1/2  slaelrgigyvfqqdallpsltvlenlllglllagellllllaakeaalralllllllgletlldrlpse
00420702   2/2  ----------------------------------------------------------------------
00440861   1/2  gllkpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlvllviddgl
00482261   1/2  slaelrgigyvfqqdallpsltvlenlllgllllgellllllaakeaalralllllllgletlldrlpse
00424962   2/2  ----------------------------------------------------------------------
00475891   1/2  sllellrrgigyvfqdpalfpgltvlenlllgllllglalkeaalra....lllllllgletlldrlvse
00509431   1/2  dliflgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdislldlrelrrlig
00390411   1/2  gadkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnllrrrg
00378981   1/2  lllslaelllllrrgigyvfqdpalfpgltvrenlalglllaglskaeaaaraaellell.....glddl
00425572   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00420701   1/2  lllslaellalrrgigyvfqdpalfpgltvrenlalglllaglskaeararalellell.....glddll
00500442   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00458601   1/2  glspqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalralllllll
00502741   1/2  slaelrgigyvfqqlallpsltvlenlalgllllglskaeaaaraaellell.....gledlldrlpseL
00466971   1/2  slaelllllrrgigyvfqdpalfpgltvlenlllgllllglllllaakeaalrlellllllgletlldrl
00379602   2/2  ----------------------------------------------------------------------
00500441   1/2  sl..lrrgigyvfqdpalfpgltvlenlllgllllglslaeaaeralelllllgl....edlldrlvseL
00404101   1/2  slaelrrgigyvfqdpalfpgltvrenlalgll........kaeararalellell..gldelldrlvge
00425571   1/2  sl..lrrrigyvfqdpalfpgltvrenlalgllllglskaeaaaralellell.....glddlldrlvge
00466932   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00436511   1/2  dgligerlrevlelirelelaelrrrigyvfqdpalpallrllalfpaltvaenlrfglglavlllldsa
00379601   1/2  virklpkliltledllelenlsfsygg..kealkdlslaiepgelvlivGptGsGKTTllkallgllppd
00361211   1/2  lslaerlragigyvfqdlalfpeltvlenlalg................rarellerlglail...drlp
00436512   2/2  ----------------------------------------------------------------------
00466931   1/2  lalspeellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllllellallld
00468691   1/2  GervglvGpnGaGKttLlkllagllkpdsgeilvdGedlrelre..lrrrigyvfqdpalfpeltvlenl
00468692   2/2  ----------------------------------------------------------------------
00485451   1/2  vlvigldifrlsarelrkrig.vfqdpallphltvpenldlgllleilervlellelvgldvvlldtyph
00436071   1/2  a.....lrrgigyvfqdpalfpgltvlenlalgllllgll.....ealaralellellglgdl...drlv
00468601   1/2  aaaerlg.igavpqdvplfpsltvldnlalar......dlleaakaagydvvlidtaglld..ldrlvge
00485452   2/2  ----------------------------------------------------------------------
00448931   1/2  a...areqlgivfqdpgl...tvlenlalgeleararellellgledydvvliDtag.....rlrlpsel
00469451   1/2  lylsleesleqlrrrigyvfqdpalfp..................aeellelvgledlldrlpge.....
00468602   2/2  ----------------------------------------------------------------------
00485931   1/2  ......rrigavpqlpvlfprltvlenlalg.gadlaeraeellellglegfdvvliDtag..rgrrvge
00469452   2/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ggesglllrdlrrliglvfqdpilfpgltvglllffldnidlgllirgdeeleaalelaglprviellle
00498252   2/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00422141   1/2  eeellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklreviltledlg
00485932   2/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00488521   1/2  .......ggkvlyvdqeeslfpltvlenlalg.....gedveellerlgl.dlldrlph...........
00498251   1/2  TtLalrllagllkpgggvvyidgeesldll...rarrlgvvlqelllfpeltveenl.............
00368501   1/2  .........gapfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpgtvlenlalgllvsel
00367481   1/2  dalll..............................................rvdeiltrvglsdl...ld
00367482   2/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00372301   1/2  .........igyvfq.....................................llerv.gledlldrlpst
00530602   2/2  ----------------------------------------------------------------------
00475371   1/2  sarellgllgell............................................gldvlvgarggdl
00437981   1/2  gkdi........rrgiglvfqliglfphltvlelvalglggilveevrellkel................
00371631   1/2  esgglkvlligtDifylpa.eqlkrigllfqkglpealdveell......................elll
00368502   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00496111   1/2  saeelrerrrrigyvfqepalfpeltvlenlalgll...............................drl
00496112   2/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00503371   1/2  sgeirldgkdlliylsdlirrgagiayveqefdlfdgltvlenvllglgdeliirrrilrdgrseyllng
00495371   1/2  tglspa..rggiglvfqteallppltvrenlealgldlrglld..rerviellelvgleelldrlpre..
00381442   2/2  ----------------------------------------------------------------------
00500611   1/2  ggkvlyislee..slrrrrigmvfqelgldpdltv..........arerviellelvgllelldrlpre.
00532531   1/2  ggfyakaigllrrkigyvfq..lfpfltvlenvalgldglvdeedleraenllalvgleeipnrypse..
00464792   2/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00464791   1/2  GervglvGpnGaGKTtLlkllagllkpdsgeivvyg.ligerpre.vrellglllelgvlf.........
00495031   1/2  vlyigleltlsperlrlraqsl.......................gldldellerllvidllelvgllel
00381441   1/2  gevdgvdltfls....reeigyvfqepallpdltvlenlylglllalllaleegkivildgdreraeell
00414121   1/2  dgqlledlgvlavrlgigyvpqtlglfpaltvlellalalllredpdlilid..................
00437941   1/2  elld................................................................ps
00462761   1/2  r......lglliglvfqdpdllpfltvlenvllpllaaglivivdgt.lllvglrealrkll........
00478412   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00451571   1/2  ....lreaiglvtqdgelllelidegilvpdeiv.iellrealeeldadgvi...ldgfprllgqaelll
00451572   2/2  ----------------------------------------------------------------------
00475381   1/2  srdllgllreglirigyvfqdyalfprltvlenvllgll.............................ll
00490731   1/2  aadellgvlaee............................................lgldvllgarggdl
00480471   1/2  lldgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllgldllllellkelkydpv
00379261   1/2  apfvevdaselteggyvgedlekrirelfqearllvfltvlenirldaseylekrvvsrligappgyvgy
00475382   2/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00379961   1/2  lldpkdlrellragiplvflnfaalpasllesel....................................
00475521   1/2  .dleplrrdigmvfqdpalfplltvrenvilgllelaglskaealarvdellelvglddellldrlp...
00484101   1/2  dldellg.igylfqdvgllpvltvrenlalllrglpgysaeeleralellelagfdvilieGllelalpl
00490732   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00489571   1/2  ......................................................................
00478411   1/2  lglkd...gigmvfqdpalfplltvrengvalgllla.glskaeieervdlllelvglddlldrypde..
00475522   2/2  ----------------------------------------------------------------------
00457311   1/2  klsreelrklrrrigmvfqdpalflnpgltvrenlaeplrllklgkk..llepvglpevldryphe....
00470731   1/2  aralakel..gagfilidgddlrekavgeleklgrdlfqvaregglvpdilfideidallrkgpd.vild
00444381   1/2  GtGKTtlakalakll..gvpfiridgselte...kelvGe..............................
00387201   1/2  elGeilldgrdlyrlsleeallllfldeileidglllvelregigyvf----------------------
00368572   2/2  ----------------------------------------------------------------------
00503741   1/2  kllagllkpkfgeillfg.............kvvyvnvselldlkellrll...................
00387202   2/2  ----------------------------------------------------------------------
00368571   1/2  eyaglarglgvvildpgdgrsvrlnplaliddeedaaellralvsemgrgeddfftpaarallralilal
00493431   1/2  pgev..rgigyvfqsgalfphlivagnllegaevhgllygtskerveeale...kgllvlldr.......
00512891   1/2  ..rsarrgigyvfq.......tveellgllaelvglevrg.................eleellktlikel
00477972   2/2  ----------------------------------------------------------------------
00496571   1/2  geplgelir..glvfqdpllldeltvlenlalgrylhl..glilaalaagvgvvldrvg..lsdlaygfp
00478442   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00513251   1/2  ......................................................................
00513762   2/2  ----------------------------------------------------------------------
00404191   1/2  .................................................................delvs
00493432   2/2  ----------------------------------------------------------------------
00495771   1/2  psGvGKStLlNaLlgellattgeipgdggdgrhtTrdvllirleglvliDtpGfrdtileni--------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  tp....lgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvildrvglsdlayd
00434401   1/2  paaelllreglgidfqlpdal.......................drellreevlellglg..evvivdvy
00499191   1/2  ......gllvgvvfqddfylllpalevlengafll.dlllpdaldrelllelllalveglvvlldryprl
00477971   1/2  rpgevdg.vgyvfqsrelfpeltvagnfleg......aevrgnlygtsrerveelleagldvlldidpqg
00406781   1/2  ase...................................................................
00464412   2/2  ----------------------------------------------------------------------
00478441   1/2  lelrg..rdilmvfqppalfpllevrglniaevlela.glskaealkrvdlvlelvgld.......dryp
00487022   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464411   1/2  eplge...ligevfqdgilfpdltvlenvalgrygll..glikealaegvivildrv..glsdla.ypgf
00439861   1/2  laanlaknggkvlyisleesreqlleraerlgldleellllgll..........................
00498812   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00513761   1/2  .ranlpeqlgidirdlidletvmelglgpngalvfaleellt.tldillealelleedydyiliD....t
00487021   1/2  lra.........gevfqdyalfphltvlelldnvllgleir...gllkaerlervevllervgl.lldri
00392701   1/2  ................................................................llgkyv
00515531   1/2  gvklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenlanv
00498811   1/2  elvaggglliglifqdfglfelldrellielllenlalglalegvildalrrrllelldll.......gl
00515532   2/2  ----------------------------------------------------------------------
00510561   1/2  DlllgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleql..rarrlgldldrll
00394721   1/2  rldlsellsv...................................................sdlvg....
00489631   1/2  rellgel.lgrgigfgfqqgdlledatvlenlalllldeidka........................led
00513252   2/2  ----------------------------------------------------------------------
00508671   1/2  vvlldgddlraglsiglilsdedraalrrrlgevfqelllagrlvvldgtalgl..elrdelrellkeag
00444382   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00468951   1/2  kaLDlllgiGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyid...teesldqlrarrlgldl
00470732   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00432181   1/2  vveldgrkl.............................................................
00498531   1/2  DallgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleql..rarrlgldldell
00489632   2/2  ----------------------------------------------------------------------
00515511   1/2  gvklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanv
00532471   1/2  elggaalldivde.grliglvfqdldllpllevlellaa............................rle
00439862   2/2  ----------------------------------------------------------------------
00477011   1/2  gggpgtrrptelrlsetpgltvlvvflelgerldllglvfqdfsllpeliel.................e
00402371   1/2  rldaselle.......................................................fgkyvg
00495772   2/2  ----------------------------------------------------------------------
00356411   1/2  kltlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenvpi
00437921   1/2  dlrgvddlreligevlqalglllgg.............................................
00405881   1/2  veldd.............grqlvlvDtpGlielaslgeglvr......qalealeradvillvvdasdpl
00480252   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00480441   1/2  regevlg.vdyvfvdrelfeelivagnlledaivhgllygtskerieealdaglgvlldgfpr.......
00437901   1/2  .gapvieidaselrd....................................................vdd
00420081   1/2  rsvggsdlleliyqlplrldlgeislddaallllslqllfaapylslnevidaarvlladefi-------
00405882   2/2  ----------------------------------------------------------------------
00386741   1/2  ............................................................pfvrldasel
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00420941   1/2  gapfiridg.............................................................
00432182   2/2  ----------------------------------------------------------------------
00367291   1/2  ........gapfirvdasellek...............................................
00480251   1/2  psapeqlgilgellgvpvvgvltgldlagalrealell.................llegydvvl....iD
00461621   1/2  revvergtelgklikdyfdpgalvpd.llirlllerllfldeg.........ggflldgfprtleqaeal
00482722   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00473941   1/2  ................................................pfielsasdllg..........
00477012   2/2  ----------------------------------------------------------------------
00527261   1/2  gyvdleellrela......................................................eel
00482721   1/2  lvaggtplgerirellgegyllpdea.lfrallaellfgdllalalldgvv..................y
00532472   2/2  ----------------------------------------------------------------------
00511381   1/2  lgielvvsriglvleavglffaldllelll........................................
00430121   1/2  ...sgvpfirinlselte................................................kllv
00533151   1/2  ggldig............evfqdaleaglllfddefrglllerleellargpvvildgf...........
00420942   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00499331   1/2  epvigagtdigevfqdlllaggllvddev..........................rrlllealdelllag
00515352   2/2  ----------------------------------------------------------------------
00472911   1/2  eggkpl...........................................................gllfe
00478082   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00478081   1/2  eairell..lgldlleilf..............................................eglll
00478391   1/2  lvgeggrlgrdlfdedrllfrellideidl........................................
00533152   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00516041   1/2  rgeelgriielfdearelvpelallfideidell........................akgkvvild...
00461622   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00521551   1/2  ...............................................................elvgkyv
00418301   1/2  .grpfirvdaselte...aelvGyesgarlrelf....................................
00416171   1/2  ........................................................dlleselfghekga
00509891   1/2  dldeplgvdrerlrrvgelalllaggglcalvaddlagaleellarala...........ggpdvil.iE
00499332   2/2  ----------------------------------------------------------------------
00496061   1/2  evepggtdlgeifqalllagellfddevlgllrerldelielllagg.vvildgf...........pldl
00469161   1/2  plgelirelllegfqdlilvpdllvlellaanragl..relikellaagkgvildrfp......lsrlay
00476071   1/2  ...ggpllerirellgegyllfdeal........................drellaallfglel.egall
00473942   2/2  ----------------------------------------------------------------------
00489391   1/2  lreavpggtdlgel.........fqdlllegellfideiaelllealae.....................
00410531   1/2  .....................................................gefvdygptigvnfktv
00521552   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00515351   1/2  dllreavpggtdigelfqdyllfpfltvdeni............rglllealeellaag.kvvild....
00476072   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00482661   1/2  viaeerlellekiieellrirldklledldeiveelppvlfddlvgqe.eakeallenlklflkgpelll
00497571   1/2  sllslldvlrpkvdfddiileeakeelllellelplklpelfkrlglkapkrrgvlLyGppGtGKTllak
00457852   2/2  ----------------------------------------------------------------------
00517691   1/2  .............................................gtlllllgllsfllalvldslpler
00476651   1/2  rvncaallelsasdll...................................................ese
00493171   1/2  regevdgv.dyvfvsgelfkeli...........dagelledaivigllyergtlldavegalldgfpvl
00480501   1/2  alvggl..................................................idgllilfledeaa
00471271   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457851   1/2  vpggtr..lgeviqdlfllggllffdeldel...............lkerieellaag.gvildgfpldl
00430122   2/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00487061   1/2  vdywaavgggdllr..................lirelllrlgf.gepdafdnellgellealleg.....
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00478131   1/2  reavgqlglglsieeldealllpdalrralleealealka------------------------------
00493172   2/2  ----------------------------------------------------------------------
00486891   1/2  eidgtplgeeirdlllagellfraevrdll......................................ye
00512062   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00491901   1/2  aklggelaeliedlfvprellidlikellk----------------------------------------
00482551   1/2  naalplelgklggkvlyisteeafsperlreralslgldleelldrllvidat.................
00459701   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00479331   1/2  lrklvgesirellelagela......................prillldeilellekggivldd......
00409841   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00512061   1/2  rea...................................................................
00491902   2/2  ----------------------------------------------------------------------
00477561   1/2  rralifqd.eldlfdedreegfrvpeelv-----------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00518511   1/2  ......................................................................
00474201   1/2  elprslpgl........................pfvrvnasdltdvglleellgkllgaat.........
00519581   1/2  ...........fgdvgglvvdli...............................................
00410321   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00457881   1/2  epdg..telgellqdlllaggllpdaivrdlllel...............leelladgkgvildgfprdl
00493981   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00503562   2/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00401211   1/2  ..............................................................ldtlkgel
00501942   2/2  ----------------------------------------------------------------------
00403151   1/2  veidgkklvkltlwDtaGqerfrslrelyyr..................................gadgv
00515801   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00483811   1/2  g...llgqpklydlleellelllde.............................................
00503561   1/2  llgeghlylplddlveellklleldelllelieleellkelleeilvellkedlelvlderrlyleelel
00494911   1/2  glpfvrvnasellealllsdlfgell............................................
00501941   1/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00490531   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00475032   2/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00381511   1/2  ....................gkrvlvlaPtrelaeqiaeelrkllgflgldlelkvallhgglslkeree
00441252   2/2  ----------------------------------------------------------------------
00469132   2/2  ----------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00348321   1/2  ......ggrvlvlvptralaeqlaerlakll..................glrvgllvgylirfestrilv
00402381   1/2  ....gvpfvrinlselteall-------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00469131   1/2  qpslslllglepeelgladlllglvdledvllktsspgldllpag.gplaglelllsealrel-------
00494912   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00381632   2/2  ----------------------------------------------------------------------
00387941   1/2  pslslll---------------------------------------------------------------
00519421   1/2  aldtryl..glvasriglsleailvtllldlfel....................................
00513312   2/2  ----------------------------------------------------------------------
00519422   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00490532   2/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00381631   1/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00513311   1/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00475031   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           SGGEQQRIAIARSIISDAPIVVLDEATAFSDPENEHLIQKAFERLMAGKTVIMVAHRLSTVVGADKIVVL
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  LSgGqrqrvalArallldpdllllDEptsgLDpetraellellrelakgltvllvthdlslaaladrilv
00379582   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00379581   1/2  vgldtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakegltvllvt
00530591   1/2  SgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelakgltvllvtHdlsealladrilvl
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  SgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelakgltvllvthdlsearladrilvl
00482262   2/2  ----------------------------------------------------------------------
00510251   1/2  ......lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgLDp
00458602   2/2  ----------------------------------------------------------------------
00490801   1/2  ....lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLDpet
00378982   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00367901   1/2  qltvlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeieeraeelle
00424961   1/2  grlgrelSgGqkqrvaiarallleragnleggGsiTalatvlveggsdpdllllDeptsalDgeivlsll
00502742   2/2  ----------------------------------------------------------------------
00475991   1/2  LSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtHdlsealrladri
00420702   2/2  ----------------------------------------------------------------------
00440861   1/2  teldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdpnlfpglvvli
00482261   1/2  LSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakgltvllvthdlsealladrilv
00424962   2/2  ----------------------------------------------------------------------
00475891   1/2  LSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelakegltvllvthdldealrladri
00509431   1/2  yvpqdpnllfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkeleeeleligp
00390411   1/2  iglvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarllellegl
00378981   1/2  ldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlse
00425572   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00420701   1/2  drlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsea
00500442   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00458601   1/2  gledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtH
00502741   1/2  SgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrladril
00466971   1/2  vseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrla
00379602   2/2  ----------------------------------------------------------------------
00500441   1/2  SgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdlsealrladri
00404101   1/2  LSgGqrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelakegltvllvthdldea
00425571   1/2  LSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealaladr
00466932   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00436511   1/2  trlaqakreisalarellervglpgdlftllsrlderagnlSgGqrqrvaiaralasdpdllilDE----
00379601   1/2  egiitiegpdel......lrnkigyvfQdpvlfpltvren..............................
00361211   1/2  geLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakelgvtvilvthdl
00436512   2/2  ----------------------------------------------------------------------
00466931   1/2  lllllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglgdlldrpvs
00468691   1/2  algallag.....................lglaeyldelgkdLSgGqrqrvalAr.....pvlLllDEpt
00468692   2/2  ----------------------------------------------------------------------
00485451   1/2  ...........elSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrtiil
00436071   1/2  seLSgGqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlalala
00468601   1/2  lsggqkqrvaiarala.apevllldeptsgldalae..llelleel..gltvlvvtKlDgtakgghdlsl
00485452   2/2  ----------------------------------------------------------------------
00448931   1/2  sggqkqrvaiaralaaplppevllldeptsglda..lrellellrel..gltvlvvthlDllakggadls
00469451   1/2  ......lSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtvilvtH
00468602   2/2  ----------------------------------------------------------------------
00485931   1/2  lsggqkqrvaiarallllldpelllldEptsglda..lrlllellkel..gltvlvvthddgtakggaal
00469452   2/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  gldtlaggggvvlsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadteeellelle
00498252   2/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00422141   1/2  lsy..gdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegriltiedp............
00485932   2/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00488521   1/2  qlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLkrlakelgvtvl
00498251   1/2  .......................drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarelle
00368501   1/2  igappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallgggrelrdgellk
00367481   1/2  rglslsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellgatvlvvtHdlelaa
00367482   2/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00372301   1/2  lsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtHdlelaalladr
00530602   2/2  ----------------------------------------------------------------------
00475371   1/2  sgglrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdldavlkaa
00437981   1/2  .......lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelakgvtvilathdlsell
00371631   1/2  dlkegledilvp...vlsggqkqrlalaralvedpdvlilDgptalldpltr.ellellkelrdlldlti
00368502   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00496111   1/2  pgeldlSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrl.kelgvtvilvth
00496112   2/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00503371   1/2  lgvslkeliellldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeellklleele
00495371   1/2  .........lsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelgvtvllvthd
00381442   2/2  ----------------------------------------------------------------------
00500611   1/2  ..........lkrsggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkrlakelgvtvllv
00532531   1/2  .....lsgGqqqrv...........illldEPtsgLdpvsr.........................lela
00464792   2/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00464791   1/2  .......................aaellervglvaatadeppgelsggqrqrlaiAraladdqgkpvlll
00495031   1/2  ldrlpre...........lsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelg
00381441   1/2  ellgldadlviilpasleellerldrrggelsggqkqRvalaral-------------------------
00414121   1/2  ...........sgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltvliv
00437941   1/2  elsggerqrvliaralladpkvlllDEidal.dpeaqnaLlklleelpkgvtvilttnrleeldpallsR
00462761   1/2  ..gl.lsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplygadiviithdl
00478412   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00451571   1/2  sggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiarallkkpailild-------------
00451572   2/2  ----------------------------------------------------------------------
00475381   1/2  gglvvildggvrqrlalarallldpdvllldeplllldaalr..........dlpdlvifldadpeelle
00490731   1/2  sgglrqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvllvvdatlgleaadri
00480471   1/2  illlnkidllddrllrraeaeerieellelv---------------------------------------
00379261   1/2  glggllteavrrlpysvllldelekahrpirvlllsaslvlllgglglpevgelllellddvgltdllgr
00475382   2/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00379961   1/2  ..........lsggerqrvalaralalrpGllvlAdggvlllDEpdal.dpevqaaLlr-----------
00475521   1/2  ...sggqqqeilrvaiallilpvllgralallpelllldeptsaldpdlveeilel--------------
00484101   1/2  ilelrelsdgqiqrvaparallrdpllllldedtvvldkvdlasild-----------------------
00490732   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00489571   1/2  .....lallelrntteagaasgsrdkgllgklkpetraelldllre..egttilvvth.ldeaeraDrva
00478411   1/2  ..lsggqrqrvaiaralalepelllldeptsaldplavvellelllglneeldiilalellll-------
00475522   2/2  ----------------------------------------------------------------------
00457311   1/2  .......lsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadlgltlirlitr
00470731   1/2  gagrtpeqlealldllee.....lgrpvvviilttnrevlldral.rRpgrllldep..eldppdreerl
00444381   1/2  ..........................segailsggfkqrvgia..lladpgilflDEidkllddrgeaeg
00387201   1/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00503741   1/2  ............lealglpppyqlsggerlrvalaeallalgkpdllilDEitnlldpetlspdvlelLl
00387202   2/2  ----------------------------------------------------------------------
00368571   1/2  aeepeptldellellselg....lrdladrleklvagglagllegaektaasilellrkllallldlggp
00493431   1/2  ....dlsggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvivn
00512891   1/2  sggekqrvalarallakpdvlllDEid.gldpdvleallelleelkrsgvtvilttndldeleladrial
00477972   2/2  ----------------------------------------------------------------------
00496571   1/2  rtlsglgqrqrvalarallkpdlviflde......ppteeldeRlrkrlrlgdteevlehrleraeelad
00478442   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00513251   1/2  ..gqkqrvalleaalkegylvvvDet..gldraqrlellelardlgrpvlviflatspevlierlldrvl
00513762   2/2  ----------------------------------------------------------------------
00404191   1/2  klsgglqeqrvaiafalarkpdllllDEidalgldpelqeellelldelaergvtlilttnnrpeeldqa
00493432   2/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  gfprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelreldseevlekrlehylelle
00434401   1/2  dlsggerqr...aralasgpdvlilDgptlgldv........lldl...pdlvifvdhdlevalerrlkr
00499191   1/2  lsggqrqrvaia.....dpdvlildgptllldp-------------------------------------
00477971   1/2  lsggqkqrlalaralilppsllrgldep.ealdarle.raleellelaegfdvvivnhdleealelldri
00406781   1/2  llgkyvgelsgglrqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrll
00464412   2/2  ----------------------------------------------------------------------
00478441   1/2  yelsggerqrvailr..vllpklllpdepgrnldvlievavlnlilkllgidallelvd-----------
00487022   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464411   1/2  .lsggeqqrvaiarallpkpdlvllldepteeldeRllkRgrllekleyikkrlehyle......laepy
00439861   1/2  ............siliadplglsgeellrvllalalelkpdlliiDeltalldaervrelrellralkrl
00498812   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00513761   1/2  pGglelrallalllaiaralaadeillvddptsgldaetqleilelllelllklgipiilvlnKlDllse
00487021   1/2  ppa...lsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpegilpdlvifld
00392701   1/2  gelsgglrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtvi
00515531   1/2  pillvlnKiDlleakeraeellellglgdlldklpse...........lsgG------------------
00498811   1/2  dvvilegplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelaplygaadividn
00515532   2/2  ----------------------------------------------------------------------
00510561   1/2  lldaltveellalaerll...................................sggkvdlvviDsltala
00394721   1/2  elegglrgllteala.lakpsvlflDEidrlldardsesslevlnaLlrlledgnvlvi-----------
00489631   1/2  ggvvlldgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarleery...
00513252   2/2  ----------------------------------------------------------------------
00508671   1/2  lpllvvfldaplevlleRdrrglypeelsgglkqrvaiarplelaaepdlvi------------------
00444382   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00468951   1/2  ddllllpaltveellala....................................erllsggkpqlvviDs
00470732   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00432181   1/2  ..........vliDtpGleefasggekqrvalalallreadvlllvvdadeptsfld-------------
00498531   1/2  llpaltveellala....................................erllsggkpdlvviDsltal
00489632   2/2  ----------------------------------------------------------------------
00515511   1/2  pillvlnKiDlleaklvllllvglfdlldglpse....lsggqkqrval---------------------
00532471   1/2  ellerippalsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslllvlplpdlvi
00439862   2/2  ----------------------------------------------------------------------
00477011   1/2  nralagpiagisrdairleielpglpdltlvDtPGlgsvavvdqlsggqkqrvala--------------
00402371   1/2  afegglrqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleeg..n------------
00495772   2/2  ----------------------------------------------------------------------
00356411   1/2  ilvlNKiDlleekiveellellgleykgdrdpee...........lsggqkqrval--------------
00437921   1/2  ...................kpdvlllDEidrl.dpdaqnallklleelpagvtlilttn-----------
00405881   1/2  ld...qpvellsggekqrlalarallgkpvilvlNKiDeptneldlellellee......lggtvvlvSa
00480252   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00480441   1/2  ....glsqaqalrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgladvvivn
00437901   1/2  lsgyvgelsggeklrellaealteavlkgkpsvlllDEidal.dpdvlnallklldglr-----------
00420081   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00386741   1/2  sggeklrgllarala.kpgvlllDEidal.dpdvqeallelleegeltivgggllteld-----------
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00420941   1/2  ....sellgkyvgelsgglrqllalara..akpsilllDEidklapkrsptsaldadvrrevln------
00432182   2/2  ----------------------------------------------------------------------
00367291   1/2  ............lvgegegrlrgalaealradpgvlflDEidalagkrgsgtsrldpevqnaLl------
00480251   1/2  tagglqrglllalaladlllvllldepllvldatagtellelakgllealgldgvvltkldlvaalgaal
00461621   1/2  skpavlsggrkqrlalaralavdpe.lildgrllgrrllplpdlvifldaspeelleRllkrgrergllv
00482722   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00473941   1/2  ...esdlrggfkqa........akpgvlflDEidrl.drevqnaLlelleelqvtilggglvvv------
00477012   2/2  ----------------------------------------------------------------------
00527261   1/2  gellellkkllkklsellglsilglelilglsggdleelleelaellkklgkpvililDEiqslld----
00482721   1/2  drlrdellaelsggqgdvliiegalllepgllplpdlvifldappevlleRllkRg..gdseeeiekrle
00532472   2/2  ----------------------------------------------------------------------
00511381   1/2  ................qdpdviliDEaqfldp....evvevlleladtgilvlvtglemdfagelfegsl
00430121   1/2  selighppg.yvGedelgvlfeaarkappsvlllDEidkl.dpdvlnaLlqlleege-------------
00533151   1/2  ........pggllqrealrrlllrpdlvifldapleelleRllkrgrlirleddseevlekrlerylkly
00420942   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00499331   1/2  gkvvildgfpggllqrealrrllprpdlvilldappeelleRllkrgrldgreddslellekrleryee.
00515352   2/2  ----------------------------------------------------------------------
00472911   1/2  daleagfrqrladlirallakgkvvild..gtglsreareellellkelg.pvlvifldadpevlleRll
00478082   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00478081   1/2  sdefrelleealalladgdvvilDgfgrlldarq..lleelllllleepppdlvifldadpevlleRllk
00478391   1/2  ..............llakgkvvildgtnlsealdealrrllr........................pdlv
00533152   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00516041   1/2  ...gtgrlleldealellgpdlvifldap...peelleRllkrgldeeaieerlerlreilepleeaddl
00461622   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00521551   1/2  gelegglrqllalaraa..npgvlflDEidklapkrsptsglddvsrrrvlnaLlrllegledl------
00418301   1/2  .....................aragigllaladpgvlflDEidkllpargssggd---------------
00416171   1/2  fgggekqrlgllrla..dggvlflDEidkl.dpdvqnaLlrvleegeltrlgggivl-------------
00509891   1/2  gagl..lplpliellrdlldlvvlvvldgivllvdaidrleaa---------------------------
00499332   2/2  ----------------------------------------------------------------------
00496061   1/2  egalllrealarallpdl.vifldapleelleRllkrgrllereddseevlekrlerylelyerliepyk
00469161   1/2  qlsggerqrlaidlegalllerllldepfpdlvifldaspeelleRllkRgre.................
00476071   1/2  dglvygvlqdrllerllaagpdvlildgpllldvellplpdlvifldappevlleRllkRggdsleeiek
00473942   2/2  ----------------------------------------------------------------------
00489391   1/2  ...............aegkvvildgtg..ldieqrealrelllelprpdlvifldadpeelleRllkrgl
00410531   1/2  evdgvklviwDtaGqerfrsllarylrgadgillvvdatdglsfeevaklleellgla------------
00521552   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00515351   1/2  ...glsggllqrvallrallrpdlviflda.......pleelleRllkR...ddseeeilerleryreel
00476072   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00482661   1/2  dlglpkgrgllLyGPpGtGKTtlakalanel...ggpvi........-----------------------
00497571   1/2  alakelgrl.pfirvn......................................................
00457852   2/2  ----------------------------------------------------------------------
00517691   1/2  ergitidvalarllldgrkilllDtP--------------------------------------------
00476651   1/2  lfgeekeaflgallerlgklalagggtvlflDEidkl.dpdvqnaLlrlleeppsnvrvilttn------
00493171   1/2  ldgalqlllllrelllkpdlvilldv--------------------------------------------
00480501   1/2  lselvlevllealegggnpdvvildgt..nlleedrellrellkrlgrpdlvifldapleellerllkr.
00471271   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457851   1/2  egaealreallragplpdlvifldapleelleRllkrgreplddteevilkrlerlrelyerli.....e
00430122   2/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00487061   1/2  ..........gkivlsarraqlleirlirpllaegkvvilDrepdsadlafagagyllggldleevkale
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00486891   1/2  lllealeaggvvldgfpldleqaellrellkelglppdlvifldappeelleRllkR...gdseevieer
00512062   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00482551   1/2  ....dlldllellerlrrl...........lsegkvdlvviDslallarael..ldepllgldarelrel
00459701   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00479331   1/2  .ggrnllrallrellspdlvifld----------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00512061   1/2  ................gkirelfgflgelvfralelgllldeiekllakgkvvildgtllgt--------
00491902   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00518511   1/2  ............................liaadlgflileifealieggflledrvvlsll..ayqgvil
00474201   1/2  .....................................fllakpgvlflDEidkl.dp-------------
00519581   1/2  ....dleaverhlldiaeellengeil-------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00457881   1/2  eqaealrallaelglppdlvifldaplevlleRllkrgddpe....ealekrlk.....lyepllelyee
00493981   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00503562   2/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00401211   1/2  ergitikigaasllldklaivsdtpgt-------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00403151   1/2  llvydvtdresfenvlswleelrellgllllegvpillvgnKlDl-------------------------
00515801   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00483811   1/2  ..gekipveliiellkdvlvsdpdviilDelpgtnlklqdletlssvaktlnfpdyvvvltvdleiilkr
00503561   1/2  delglaellkelleeleideklldkilddlegilplnpeQkeaieailkgrvvli---------------
00494911   1/2  .................gallralfellrgalelakggvlflDEidrl.spdvqnaLl------------
00501941   1/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00490531   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00475032   2/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00381511   1/2  aledl.geadilvaTpgrlldllrd.........lknldlvilDEahrlldeqr----------------
00441252   2/2  ----------------------------------------------------------------------
00469132   2/2  ----------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00348321   1/2  vtyglllrll.dlllsdfdliiiDEahelsaetdlllglllellelrpdlkvlll---------------
00402381   1/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00469131   1/2  ----------------------------------------------------------------------
00494912   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00381632   2/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00519421   1/2  ........llrlllrgdidviliDEaqfldd....elveqlrllanlgilvivaGldtdfrgelfegsaq
00513312   2/2  ----------------------------------------------------------------------
00519422   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00490532   2/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00381631   1/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00513311   1/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00475031   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           DGGRKVEEGTHQELLAASGTYAKMWRQYTEAVEWGIEAAPRDDTRSSEATAPHATQGVSAEEYDPAEKPG
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  lddGrivelgtpe---------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00379581   1/2  hdldealrladrilvlddGrivelgtpeell---------------------------------------
00530591   1/2  ddGriveegtpeellenpgllylllleegl----------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ddGrivelgtpeellenpgllytllllgeel---------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00510251   1/2  etraellellrelakegktvllvtHdlsealladrilvlddGriveegtpee------------------
00458602   2/2  ----------------------------------------------------------------------
00490801   1/2  raellellrelakegktvllvtHdl---------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00367901   1/2  llglgglldrpvs---------------------------------------------------------
00424961   1/2  lalkrlyPaidvll--------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00475991   1/2  lvlddGriveegtpeellenpgllaal-------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00440861   1/2  saltgegldeltvrenlalglrlr----------------------------------------------
00482261   1/2  lddGrivelgtpeellenpgllytllllsslp--------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00475891   1/2  lvlddGrivelgtpeellenpgllaall------------------------------------------
00509431   1/2  lldglellvglnglldrplselSgGek-------------------------------------------
00390411   1/2  keeaekaka-------------------------------------------------------------
00378981   1/2  alrladrilvlddGri------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00420701   1/2  lrladrilvlddGriv------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00458601   1/2  dldealrladrilvlddGriveegt---------------------------------------------
00502741   1/2  vlddGrivelgtpeellenpgllytllllgsl--------------------------------------
00466971   1/2  drilvlddGrivel--------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00500441   1/2  lvlddGrivelgtpee------------------------------------------------------
00404101   1/2  lrladrilvlddGrivelgtpeelle--------------------------------------------
00425571   1/2  ilvlddGrivelgtpe------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00379601   1/2  .................-----------------------------------------------------
00361211   1/2  dlldsallrpgkrpl-------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00466931   1/2  tLSGGerqrvala---------------------------------------------------------
00468691   1/2  sgldalre..ilellrellkelgytvllvthdls------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00485451   1/2  vthdlreae.adrilvl-----------------------------------------------------
00436071   1/2  dr--------------------------------------------------------------------
00468601   1/2  alrladrilvlgvGeivedgtpfe----------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00448931   1/2  laleladrilvlgdGeivedgtpe----------------------------------------------
00469451   1/2  .......Asdrvlvl-------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00485931   1/2  slaleladrilvlgdGeivedgt-----------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  rlar------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00422141   1/2  ieyvfqspnlfpl.--------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00488521   1/2  lvthdldevarladr-------------------------------------------------------
00498251   1/2  llrrllrlakelgvtvllvt--------------------------------------------------
00368501   1/2  alkeaeaeelle..llglkdlllrkps-------------------------------------------
00367481   1/2  laadrivvlngrvva-------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00372301   1/2  vvvlndgrivavgtpe------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00475371   1/2  drilvldlggivlnkld..lvakggaal------------------------------------------
00437981   1/2  pallsrcqvirfpplseeelleildrilvleggklvedgaleelael-----------------------
00371631   1/2  lvdadlevlleR----------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00496111   1/2  dleeaedladsgr---------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00503371   1/2  ellkelekrlelleke------------------------------------------------------
00495371   1/2  leeveeladrvavl--------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00500611   1/2  thdlreveeladkr--------------------------------------------------------
00532531   1/2  driyvllsGrivesgtteelltepkatfsacfaapf----------------------------------
00464792   2/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00464791   1/2  lDEptsglda------------------------------------------------------------
00495031   1/2  vtvilvthdlreve--------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00414121   1/2  lnKiDllselthdle-------------------------------------------------------
00437941   1/2  fdviefpppdeeelleilkl--------------------------------------------------
00462761   1/2  sieevadrila-----------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00475381   1/2  RllkRgr---------------------------------------------------------------
00490731   1/2  lvlleglgvpgvvlNkldlvaeg-----------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00379261   1/2  tvdfkntiiiltsnv-------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00489571   1/2  vldd......Gtpee-------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00457311   1/2  dlgeagrsadrvl.--------------------------------------------------------
00470731   1/2  eilkrllkklgt----------------------------------------------------------
00444381   1/2  ggdvsregvqnaLlrl------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00503741   1/2  rlleegkltdkllgltlil---------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00368571   1/2  afdl------------------------------------------------------------------
00493431   1/2  ddleealeelldiivvlllgl-------------------------------------------------
00512891   1/2  lrrgrivelgpls---------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00496571   1/2  rlialyegavvvidasglsleevveeileileel------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00513251   1/2  lldegslvdlgvledl------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00404191   1/2  llrllsrl...drvivldlppdleergeilkrla------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  kadrvvvidagg----------------------------------------------------------
00434401   1/2  l---------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00406781   1/2  sgv-------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464411   1/2  k.....dd--------------------------------------------------------------
00439861   1/2  akelgvtvilv-----------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00513761   1/2  eglelv----------------------------------------------------------------
00487021   1/2  adpeelleRllkRgresergepldl---------------------------------------------
00392701   1/2  attnrpeeldpallrp------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00498811   1/2  dlsleevvd-------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00510561   1/2  palelsllldeptsgldasllreilrllkrlakelgv---------------------------------
00394721   1/2  ----------------------------------------------------------------------
00489631   1/2  ..........radlvivtddl.....--------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00468951   1/2  ltalrpa---------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00498531   1/2  apsllll---------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00532471   1/2  yldadpeelleRllkRgrdpeeqerldd------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00405881   1/2  hdgegldelld-----------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00480441   1/2  ddleealel-------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480251   1/2  svalilglpilflg--------------------------------------------------------
00461621   1/2  rlddleerilkrdlrdylrei-------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00482721   1/2  ryreiaplleaad..lvidndg.sleevveqi--------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00511381   1/2  l---------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00533151   1/2  erl.....iepyeeaddvivid------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00499331   1/2  ....ltrdlielyeeadrvivida----------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00472911   1/2  krgrallreevldrllevrepyel----------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00478081   1/2  Rgrrerkddsee----------------------------------------------------------
00478391   1/2  i---------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00516041   1/2  vidtanldleevveeilellee...pll------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00496061   1/2  .....kadyvividasgs----------------------------------------------------
00469161   1/2  ........ergrdldteevieerlervrdey---------------------------------------
00476071   1/2  rleryle.........laplyeead..lv-----------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00489391   1/2  rperegds--------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00515351   1/2  eplleeyd--------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00480501   1/2  ..gredlslevllkrle..plyeelilpt-----------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457851   1/2  pyeeaddv--------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00487061   1/2  elllvlpkpdlv----------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00486891   1/2  lerllrllerll----------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00482551   1/2  lrlLkrl---------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00518511   1/2  dggglvled-------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00457881   1/2  adylividaslsiee.vveei-------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00503562   2/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00483811   1/2  nl--------------------------------------------------------------------
00503561   1/2  ----------------------------------------------------------------------
00494911   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00490531   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00475032   2/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00469132   2/2  ----------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00469131   1/2  ----------------------------------------------------------------------
00494912   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00381632   2/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00519421   1/2  ----------------------------------------------------------------------
00513312   2/2  ----------------------------------------------------------------------
00519422   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00490532   2/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00381631   1/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00513311   1/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00475031   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           KPSSGRAPWLQRTFNLSDEGYVGLKRSAIACTLSDLALMIPFVCTVAAFAALVGTLAGEPFDAAALWSIF
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00422812   2/2  ------------------------kkllllalllallaallslllplllgrlidallpgg.dlsllllla
00422811   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00530602   2/2  ------------------------epkRllrylkpykkllllalllsllaallslllplllgqlidalll
00475371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00503562   2/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00503561   1/2  ----------------------------------------------------------------------
00494911   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00490531   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00475032   2/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00469132   2/2  ----------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00469131   1/2  ----------------------------------------------------------------------
00494912   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00381632   2/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00519421   1/2  ----------------------------------------------------------------------
00513312   2/2  ----------------------------------------------------------------------
00519422   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00490532   2/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00381631   1/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00513311   1/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00475031   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           AVGLAGMVVVFVASRNDYKKTYVAAYTESEGTRLRLADHLRKLPMSFFNRRDTTDVADRIMGDVTAQESM
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00422812   2/2  llllllallrallsylrsyllarlgqrllarlrsrlfrkllrlplsffdktstGdllsrltnDveaidel
00422811   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00530602   2/2  gg.dlsdpllllstlllllllllllallrallsylrsyllarlgqrlsarlrlrlfrkllrlplsffdkt
00475371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00503562   2/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00503561   1/2  ----------------------------------------------------------------------
00494911   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00490531   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00475032   2/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00469132   2/2  ----------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00469131   1/2  ----------------------------------------------------------------------
00494912   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00381632   2/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00519421   1/2  ----------------------------------------------------------------------
00513312   2/2  ----------------------------------------------------------------------
00519422   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00490532   2/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00381631   1/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00513311   1/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00475031   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LSSTLPQLIAGIVSTVVICAMLAFFDWRLACCVMVTLPLSAGVIALSRRHQSRLFERQNRVRLDALACVQ
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00422812   2/2  lssllltllralltllgalivlfylswrlalvlllllpllllltllfgkrlrklsrlvqealselnsvlv
00422811   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00530602   2/2  stGdllsrltnDveaidellssllltlllalltligalivlfliswklalvlllllpllllltllfgkrl
00475371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00503562   2/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00503561   1/2  ----------------------------------------------------------------------
00494911   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00490531   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00475032   2/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00469132   2/2  ----------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00469131   1/2  ----------------------------------------------------------------------
00494912   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00381632   2/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00519421   1/2  ----------------------------------------------------------------------
00513312   2/2  ----------------------------------------------------------------------
00519422   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00490532   2/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00381631   1/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00513311   1/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00475031   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           DYLEGIKDMRACRAVGKDSAAMEQAMLELKRVTMRVELAVDVSVSLASAILRSGVGLTACVGAVLLASGG
00422802   2/2  ----------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00379582   2/2  ----------------------------------------------------------------------
00482202   2/2  ----------------------------------------------------------------------
00490802   2/2  ----------------------------------------------------------------------
00510252   2/2  ----------------------------------------------------------------------
00530592   2/2  ----------------------------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00367902   2/2  ----------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00482262   2/2  ----------------------------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00458602   2/2  ----------------------------------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00378982   2/2  ----------------------------------------------------------------------
00509432   2/2  ----------------------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00475892   2/2  ----------------------------------------------------------------------
00475992   2/2  ----------------------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00502742   2/2  ----------------------------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00420702   2/2  ----------------------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424962   2/2  ----------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  ----------------------------------------------------------------------
00440862   2/2  ----------------------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00500442   2/2  ----------------------------------------------------------------------
00404102   2/2  ----------------------------------------------------------------------
00466972   2/2  ----------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379602   2/2  ----------------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00466932   2/2  ----------------------------------------------------------------------
00361212   2/2  ----------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00468692   2/2  ----------------------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00485452   2/2  ----------------------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00469452   2/2  ----------------------------------------------------------------------
00372302   2/2  ----------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00498252   2/2  ----------------------------------------------------------------------
00422142   2/2  ----------------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00422812   2/2  eslsgirtvkafgaeerelerfeealdelrkaslklarlsallspllqllsalalalvlllgallvlnge
00422811   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00367482   2/2  ----------------------------------------------------------------------
00488522   2/2  ----------------------------------------------------------------------
00437982   2/2  ----------------------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00530602   2/2  rklsrlaqealselnsllveslsgirtvkafgaeerelerfdealdellkaslklarlsallspllells
00475371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00496112   2/2  ----------------------------------------------------------------------
00475372   2/2  ----------------------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00495372   2/2  ----------------------------------------------------------------------
00503372   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00500612   2/2  ----------------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00437942   2/2  ----------------------------------------------------------------------
00495032   2/2  ----------------------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00503742   2/2  ----------------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00392702   2/2  ----------------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00439862   2/2  ----------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00503562   2/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00503561   1/2  ----------------------------------------------------------------------
00494911   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00490531   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00475032   2/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00469132   2/2  ----------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00469131   1/2  ----------------------------------------------------------------------
00494912   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00381632   2/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00519421   1/2  ----------------------------------------------------------------------
00513312   2/2  ----------------------------------------------------------------------
00519422   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00490532   2/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00381631   1/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00513311   1/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00475031   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           VDFMVLLMFLLIVSRVYGPILALVSQLPNLLNLSTKTARIKAVMDEPEARGSASADVPGHDLSFQGVRFG
00422802   2/2  -------------------------------------------------------------llllllall
00422801   1/2  ----------------------------------------------------------------------
00379582   2/2  -------------------------------------------------------------leplleven
00482202   2/2  -------------------------------------------------------------llllelknl
00490802   2/2  -------------------------------------------------------------lllllllla
00510252   2/2  -------------------------------------------------------------lllllllll
00530592   2/2  -------------------------------------------------------------llllllale
00379581   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00367902   2/2  -------------------------------------------------------------lelknlsls
00482201   1/2  ----------------------------------------------------------------------
00482262   2/2  -------------------------------------------------------------lllevenls
00510251   1/2  ----------------------------------------------------------------------
00458602   2/2  -------------------------------------------------------------lllevenls
00490801   1/2  ----------------------------------------------------------------------
00378982   2/2  -------------------------------------------------------------lpllelenl
00509432   2/2  -------------------------------------------------------------Mlelknlsl
00390412   2/2  ---------------------------------------------------------------Mknlslr
00475892   2/2  -------------------------------------------------------lllelllevknlsks
00475992   2/2  -------------------------------------------------------------lllaaelpe
00367901   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00502742   2/2  -------------------------------------------------------------lllevenls
00475991   1/2  ----------------------------------------------------------------------
00420702   2/2  -------------------------------------------------------------lpllelenl
00440861   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424962   2/2  ---------------------------------------lgepldglgplr.....papgllelenvsks
00475891   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  -------------------------------------------------------------lelenlsks
00440862   2/2  ---------------------------------------------------Mpllslgepllelenlsks
00420701   1/2  ----------------------------------------------------------------------
00500442   2/2  -------------------------------------------------------lllelllelknlsks
00404102   2/2  --------------------------------------------------------------elenlsks
00466972   2/2  --------------------------------------------------------llalllevknlsks
00458601   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379602   2/2  ---------llllpllllpdeplaaldvalqralvslerllellvdpgasdihinpggpvrvridgvlel
00500441   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00466932   2/2  ------------------------------------------------------------------Mkll
00361212   2/2  ----------------------------------------------------plellgepllelenlsks
00436072   2/2  -------------------------------------------------------------pllelenls
00436511   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00436512   2/2  ---------------------------ievpvglallgrvldllgepid.gkgplelgepllevenlsks
00466931   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00468692   2/2  -------------------------------------------------------------lsvpvglal
00485451   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00485452   2/2  --------------------------------------------------------------------sk
00448931   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00468602   2/2  ----------------------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00469452   2/2  ------------------------------------------------------------allelenlsk
00372302   2/2  -------------------------------------------------------------yvlPllsdg
00426051   1/2  ----------------------------------------------------------------------
00498252   2/2  -----------------------------------vekllglalllieklflkvlprllsllelenlski
00422142   2/2  -------------------------------------------------------------dlsleelek
00426052   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00485932   2/2  ----------------------------------------------------------------------
00422812   2/2  ltvgdlvafllyalqllgplsqlgsllselqrarvaaeRi....D.P-----------------------
00422811   1/2  ----------------------------------------------------------------------
00448932   2/2  ----------------------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00367482   2/2  ---------------------------------------------------------yvrPelldeplle
00488522   2/2  ---------------------------------------------------lllllalelllevenlris
00437982   2/2  ---------------------------------------------------------lveklrpknldkv
00372301   1/2  ----------------------------------------------------------------------
00530602   2/2  alalalvlllgaylvlngeltvgdlvafllyalrllgplrqlgsllselqralaaaerife---------
00475371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00368502   2/2  ----------------------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00496112   2/2  ---------------------------------------------------------------elenltk
00475372   2/2  ----------------------------------------------------------------------
00371632   2/2  ------------------------------------------------------------mseliiylel
00495372   2/2  ------------------------------------------------------esalellleledltkl
00503372   2/2  ----------------------------------------------------------------------
00532532   2/2  ----------------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00464792   2/2  -------------------------------------------------------------lsvpvgdkl
00500612   2/2  ---------------------------------------------------pgllsllelllelenltkl
00480472   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00437942   2/2  ------------------------------------------------------lrplveklrpknlddv
00495032   2/2  ------------------------------------------------------lsalellleledltki
00464791   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00379262   2/2  ----------------------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00457312   2/2  ----------------------------------------------------------------------
00512892   2/2  ----------------------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------yrpvdfddi...
00379961   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00490732   2/2  ----------------------------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------llgvrllpplppklagllplagladgd..glgvllG
00503741   1/2  ----------------------------------------------------------------------
00387202   2/2  ------------------------------------------------------mssgepllevenlskr
00368571   1/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00489572   2/2  ----------------------------------------------------------------rvknls
00434402   2/2  ------------------------------------------------------------------lsks
00533502   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00493432   2/2  ----------------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00503742   2/2  ---------------------------------------fifldlrplallplpdrlvgrdeeiealska
00533501   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00464412   2/2  ----------------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00392702   2/2  ---------------------------------------------eklrpvllddvvgqeeakealleal
00406782   2/2  -------------------------------------------plveklrpvllddvigqeeakeallea
00404192   2/2  -------------------------------------------------------vellpkvtlddlvgl
00464411   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00510562   2/2  ----------------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00513252   2/2  ----------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00444382   2/2  ----------------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00439862   2/2  -------------------------------------------------------------kleeveris
00477011   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00495772   2/2  -------------nellrpivanvdlvlivvdardplfslnlllrylvlaeaagippvlvlnKiDlleee
00356411   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00356412   2/2  ---------------------------------------------------------------lknlsks
00386742   2/2  -----------------------------------------------klrpvllddvvgqeeakeal...
00394722   2/2  ----------------------------------------------------------------------
00498532   2/2  ----------------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00480442   2/2  ----------------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------eelrkl
00527261   1/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------lrpvllddvi..
00367292   2/2  -------------------------------------------------------------vtlddvv..
00496062   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------diigqe
00482661   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00418302   2/2  -----------------------------------------drplleklrpvllddviGqeeak......
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  ----------------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00503562   2/2  ----------------------------------------------------------------------
00497572   2/2  ---------------------------------------------------------------aselvqw
00378621   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00503561   1/2  ----------------------------------------------------------------------
00494911   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00490531   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00471272   2/2  -----------------------------------------------------------prailelesli
00464592   2/2  ----------------------------------------------------------------------
00475032   2/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00441252   2/2  -------------------------------------------------------------lkyqgvefi
00469132   2/2  ----------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00470232   2/2  --------------------------------------------------------------elaellsl
00387942   2/2  ----------------------------------------------------------------------
00469131   1/2  ----------------------------------------------------------------------
00494912   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00381632   2/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00519421   1/2  ----------------------------------------------------------------------
00513312   2/2  ----------------------------------------------------------------------
00519422   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00490532   2/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00381631   1/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00513311   1/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00475031   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           YGDEEVLHGVSFVAREGEVTALVGPSGSGKSTCAQLAAKFWEPDSGRVLCSGKDIAEFSEESWLAHVSIV
00422802   2/2  llllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGe
00422801   1/2  ----------------------------------------------------------------------
00379582   2/2  lsksyggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldglditalslaelrrr
00482202   2/2  sksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilglslkelrgig
00490802   2/2  lllelleeeeellllllalllllgdpllelenlsksyggvpalkdvsltikpGeivalvGpnGsGKSTLl
00510252   2/2  aeellelleeeelllllllllllllgdpllelenlsksyggvpalkdvsltikpGeivalvGpnGsGKST
00530592   2/2  elpllgelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldg
00379581   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00367902   2/2  yg.ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidlilkgllllprstv
00482201   1/2  ----------------------------------------------------------------------
00482262   2/2  ksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdildlslaelrgigy
00510251   1/2  ----------------------------------------------------------------------
00458602   2/2  ksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkditglspqelrrlgg
00490801   1/2  ----------------------------------------------------------------------
00378982   2/2  sksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllllslaelllll
00509432   2/2  snfr..vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllragglsdliflgslirsg
00390412   2/2  ygnfralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgklsdlirrgadkasvelvfe
00475892   2/2  yggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilglsllellrrgigy
00475992   2/2  lgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdil
00367901   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00502742   2/2  ksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilglslaelrgigy
00475991   1/2  ----------------------------------------------------------------------
00420702   2/2  sksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgldllllslaella
00440861   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424962   2/2  ygtgialidlslpigkGervalvGpsGaGKttLlrliaglldpdsgeilldgvdigersrevtelleelr
00475891   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  yggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllalsl..lrrrigyv
00440862   2/2  yggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKStLlnaLlgllkpdegvilv
00420701   1/2  ----------------------------------------------------------------------
00500442   2/2  yggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsGeilldgkdildlsl..lrrgigyv
00404102   2/2  yggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgldltalslaelrrgigyv
00466972   2/2  yggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilglslaelllllrrg
00458601   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379602   2/2  llvvldllsldleellalasriavlagrdiserrlpldgallpdgsrvrvrlsplptllggeslvirklp
00500441   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00466932   2/2  slslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeilldgkdilalspeellrll
00361212   2/2  yggitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvlldgleisalslaerlragig
00436072   2/2  ksygg.lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldlla.....lrrgig
00436511   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00436512   2/2  yggrklvlepletgialddvsltikkGervglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlre
00466931   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00468692   2/2  lgrvldvlgepidglgplllllllpivrlappllelenlsksygtgialidvsltigrGervglvGpnGa
00485451   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00485452   2/2  iygd.ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpllltggkvlvigldifrl
00448931   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00468602   2/2  --------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyraaaae.rlgigav
00485931   1/2  ----------------------------------------------------------------------
00469452   2/2  iyggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgkdvlylsleesle
00372302   2/2  mpllelenlrkpyggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpasggilvdgedl...
00426051   1/2  ----------------------------------------------------------------------
00498252   2/2  ytgipal.dvslglgGlppGeivlllGpsGsGKTtLalrllagllkpgggvvyidgeesldll...rarr
00422142   2/2  llelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlielifldeeellallsr
00426052   2/2  --------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdlggesglllrdlr
00422141   1/2  ----------------------------------------------------------------------
00485932   2/2  -----------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi.........rrigav
00422812   2/2  ----------------------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00448932   2/2  ------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarla...areqlgiv
00488521   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00367482   2/2  lengrhPllsksyggkvvlndislsip.gellvitGPngsGKSTllralaglllpasggilvpgedalll
00488522   2/2  tgikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGei...............ggkvl
00437982   2/2  igqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldgkdi........rrgi
00372301   1/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00368502   2/2  kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGppGvGKTtlaral
00530601   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00496112   2/2  lytgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliiglelsaeelrerrrri
00475372   2/2  -----alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDirrpsarellgllgel
00371632   2/2  selewallradvgltlteaelkrlkglndlleledlskiygplsrlikllleellrllgklalddvslsv
00495372   2/2  stgikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp...evlvdgldltglspa..rggi
00503372   2/2  -----Mmlkslelknfkslkdvsligdfspg.ltaivGpNGsGKStlldaiagllgpdsgeirldgkdll
00532532   2/2  ---vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinleggfyakaigllr
00503371   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprlgevdgvdltfls
00500611   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00464792   2/2  lGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgivlidvslpigkGervglvGpnGa
00500612   2/2  ptgipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapdsgeillggkvlyisleeslrrrri
00480472   2/2  ----------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilgeilldgkdltlvdt
00414122   2/2  --------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeilidgqlledlgvla
00437942   2/2  ygqeevlkalslalekgrpehlllvGppGtGKTtlakalaglllptsggvrvlgidaselld........
00495032   2/2  stgipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglgliplggkvlyiglelt.lsperl
00464791   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00478412   2/2  -Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.....Gtilldg.dlvrlglkd...gigmv
00462762   2/2  yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddlr......lglli
00379262   2/2  drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLvGppGvGKTtlaralA
00451571   1/2  ----------------------------------------------------------------------
00451572   2/2  ------------MsikkgeiiaivGppGsGKsTlaklLakll....glivldgddl.......lreaigl
00475381   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00475382   2/2  ---------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlavlsrdllgllreg
00457312   2/2  --------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddlyklsreelrklrr
00512892   2/2  -----------------evilltGppGvGKTTlakalagelgakfgsvsltgrdv.....rsarrgigyv
00484102   2/2  ---------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldigrldldellg.igyl
00379962   2/2  vGqeealralslalaagppegvllvGppGtGKstlaralagllppdsgrivlvgnlsdlldpkdlrellr
00379961   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00490732   2/2  --------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpyrpaadellgvlaee
00496572   2/2  ---------------GkgelivllGpsGsGKsTlarlLagll...ggsvldtgepirgeplgelir..gl
00489571   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00475522   2/2  --evlalhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvdg.dlvdleplr..rdigmv
00457311   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00368572   2/2  kll....dgvpvtldlgelgrhllivGptGsGKStllrllaglllpdggrviviDpkgeyaglarglgvv
00503741   1/2  ----------------------------------------------------------------------
00387202   2/2  yggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftlvreyelGeilldgrdl
00368571   1/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00477972   2/2  --------------hkgelvvlvGPsGaGKsTLlnaLlgll.ptsgvisvsgttrpprpge..vdgvgyv
00496571   1/2  ----------------------------------------------------------------------
00478442   2/2  -aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.....Gailvdd.dlvllelrg..rdilmv
00499192   2/2  ---------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd..............gllvgvv
00489572   2/2  ksyggktalddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt........................
00434402   2/2  yggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyrpaaelllreglg
00533502   2/2  ----------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepigtp....lgrgig
00513251   1/2  ----------------------------------------------------------------------
00513762   2/2  -----------------kiiaivGkgGsGKTTllnklaglla.dggkvlvidlDparanlpeqlgi....
00404191   1/2  ----------------------------------------------------------------------
00493432   2/2  ---------------kGelivllGpsGaGKsTllkllagllgptsgvisvggttreprpgev..rgigyv
00495771   1/2  ----------------------------------------------------------------------
00503742   2/2  lgg..aldgvslsiepggivllvGppGvGKTtLakllagllkpkfgeillfg...............kvv
00533501   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00464412   2/2  -------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsgeplge...ligev
00478441   1/2  ----------------------------------------------------------------------
00487022   2/2  -----------------rmkiivltGpsGsGKsTlarlLaell....gvvvidtddllra.........g
00392702   2/2  agarlaledlslgirpgknvlLvGppGvGKTtlaralagllgapfgrvdasd..................
00406782   2/2  laglrlllkdlslgippgknvllvGppGtGKTtlakalagelgvpfvrisase.................
00404192   2/2  eelkealkealellslgikpgeivllyGppGtGKTtlakalanelkkrggrvlyvsa.............
00464411   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  ----------------kPgkiigltGpsGsGKsTlarlLae.l....gvividgddltrelvagggllig
00510562   2/2  ---------------ldglgepldgllpilaklfrpievlalgllerksverlstGikaLDlllgiGglp
00513761   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00515532   2/2  ---------------kgekvallGlsgsGKSTllnrllglefaygpTigptsgtieidgvklqlwDtgGq
00510561   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00513252   2/2  ---iellsdlslsipspevvllvGppGsGKstlakklaell....gfilidaddlr..............
00508671   1/2  ----------------------------------------------------------------------
00444382   2/2  asdelekllelrpvlledvigqeeakkalslalelplkrlelfgklddligrspairrllellgarpgen
00508672   2/2  --------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgsgvvlldgd
00468951   1/2  ----------------------------------------------------------------------
00470732   2/2  ---------------arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTlaralake
00420082   2/2  ------------smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllvgEPiaywrsvggsdlleli
00468952   2/2  -------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgikaLDlllgiGgl
00432181   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00489632   2/2  ---------------MkgklillvGppGsGKtTlaraLaellglpf..iridgddllrellgel.lgrgi
00515511   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00439862   2/2  tgipeldellgGglpkgslilitGppGsGKTtlalqlaanlaknggkvlyisleesreqlleraerlgld
00477011   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00495772   2/2  edlelleellkelesi........gvdvvlvsakkgalldilldil.....kgktvalvGpsGvGKStLl
00356411   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00480252   2/2  --------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDpyrpsapeqlgilge
00515512   2/2  ---------------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegtieidgvklqlwDtgGq
00480441   1/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------gervglvGrpgaGKSTLlnaltglkaivsgypgttldpnlgvveldd.......
00386741   1/2  ----------------------------------------------------------------------
00356412   2/2  ygilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtieidgvkltlwDtgGqes
00386742   2/2  ...lealkavllgirpgehllLvGppGtGKTtlaralagelgapfvrlda....................
00394722   2/2  vgreealeallealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpvvrldlsellsv..
00498532   2/2  ---------------ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDallgiGglp
00402372   2/2  ---eallealrr..rpgrnvllvGppGvGKTtlaralagllvrssgpilldgvpfvrldaselle.....
00420941   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlgvveldgrkl...
00367291   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------kgkiigltGpsGsGKsTlarlLae.l....glpvidtddlyrelvaggtplger
00437922   2/2  vgqeealerlllalkagklphlllvGppGvGKTtlaralarlllgsgggvdvieldasdl..rgvddlre
00511382   2/2  ----------llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilvkdaidtrlgielvvsrigl
00480442   2/2  -----------------rlivllGpsGaGKsTlaklLaell.p..glivisvgdttrepregevlgvdyv
00473941   1/2  ----------------------------------------------------------------------
00477012   2/2  ldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrptelrlsetpgltvlv
00527261   1/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00532472   2/2  ---------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvgelggaalldivd
00511381   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00420942   2/2  .gqeeakeallealalplkrldlglslgirpgkgvllyGppGtGKTtlakalagelgapfiridg.....
00367292   2/2  .gqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanel..gapfirvda...
00496062   2/2  ----------------gklivltGppGsGKtTlaklLaerl....glpvistddllreevepggtdlgei
00499331   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------mngklivltGppGsGKtTlaraLaerl....glpvistddllreavpg.gtdig
00472911   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------gkvivltGppGsGKtTlarlLaellkplgggvvvi..dtddlrreairelllgl
00437902   2/2  -------lflslgirpgrillLyGppGvGKTtlakalakel..gapvieidaselrd.............
00478081   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------MsldikkgklivltGppGsGKtTlarlLaerl....glpfistddllrelvpggldig.e
00469162   2/2  -----------------llIvieGppGsGKsTlaklLaerlgltglsvlltredgfgtplgelirellle
00516041   1/2  ----------------------------------------------------------------------
00461622   2/2  ---------------mkgmiialtGppGsGKsTlaklLaerl....glpfistddlyrevvergtelgkl
00527262   2/2  npfilgpkvdledfigreeelkeleeal..pkivlltGprGsGKTtllkalakel..gkpviyidlsels
00487062   2/2  --------------ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvviyepvdywaavgggdll
00521551   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00499332   2/2  ----------PslslkkgklivltGppGsGKtTlakaLaerl....glpfidtddllrepvigagtdige
00496061   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00473942   2/2  vgqeevkkalllalalallrgepgehvlLvGppGtGKTtlaralagllga....................
00489391   1/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00521552   2/2  igqeeakeallealarlkapelflslglrpgkgvlLvGppGtGKTtlaralagllgapfvrlsas.....
00472912   2/2  ---------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrglageggkpl...
00515351   1/2  ----------------------------------------------------------------------
00476072   2/2  ----------------kgkiigltGpsGsGKsTlaklLaelglpvidtddltregvll...ggpllerir
00478132   2/2  ----------------kgkvivltGppGsGKtTlarlLaellkplglgvvvidg................
00478392   2/2  -------------msikkgklilltGppGsGKtTlaralaerl....glpvidgddllrelvgeggrlgr
00416172   2/2  eakkallealslaartgenvllvGppGtGKttlaralakllprsgvpfvrvncsalte............
00482661   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00457852   2/2  ---------------PkgklivltGppGsGKtTlakaLaerl....glpvistddllreavpg.gtrlge
00517691   1/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00418302   2/2  ...kallealalplkrlelfeklrgirpgknvlLvGppGtGKTtlaralakllgr...............
00509892   2/2  ------------------pkvigitGpsGsGKTTlanaLarllkarglkvavidrdpgrldldeplgvdr
00477562   2/2  ---------------kkpkvillvGppGsGKtTlaraLakrlaelgkgvvvidtddlrr...........
00457851   1/2  ----------------------------------------------------------------------
00430122   2/2  vgqeeakeallealrrgrkglelgirpggnvllvGPpGvGKTtlakalagllfpsgvpfiri..nlselt
00516042   2/2  ----------------mlkgklillvGppGsGKtTlaralaeel....glpfvvidaddl..lrgeelgr
00487061   1/2  ----------------------------------------------------------------------
00519582   2/2  ---------------kpkvilltGppGvGKttlarlLakll...glpliidldalaell....fgdvggl
00477722   2/2  ---------------kpklilltGppGsGKttlaraLaeel....glpfidtddll.......relvgeg
00478131   1/2  ----------------------------------------------------------------------
00493172   2/2  ----------------mgklivllGpsGaGKsTlaklLaekl....glivlsvgdttrepregevdgvdy
00486891   1/2  ----------------------------------------------------------------------
00512062   2/2  --------------kkkkgklivltGppGsGKtTlakaLaerl..g.glvvidtddllrea.........
00457882   2/2  ---------------mgklivltGppGsGKtTlaklLaerl....glpvidtddllrelepdg.telgel
00441251   1/2  ----------------------------------------------------------------------
00410532   2/2  ----gelknlslelkkglkillvGlngvGKTtllkrlag...............................
00477721   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00517692   2/2  ---------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg..................
00479331   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------kpklilltGppGsGKttlaraLaeel....glpfidaddllr..elvg......
00512061   1/2  ----------------------------------------------------------------------
00491902   2/2  --------------lmkgkiilltGppGsGKttlakaLaeel....glpfidtddllreaklggelaeli
00477561   1/2  ----------------------------------------------------------------------
00482662   2/2  -------------kkvaivllsnyalsislddlllildlykevqvaydnfykvdesdiayqyallakede
00518511   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00410322   2/2  yggllllkdlslelkkglkilllGlngaGKTT--------------------------------------
00480502   2/2  ----------------MgklillvGppGsGKtTlaralaell..g.gvvvidgddlrralvggl......
00486922   2/2  -----------------mlivltGppGsGKtTlakaLaerl....glpfistddllreavpggtd.lgel
00483812   2/2  ----------------PkvillsGpPGvGKTtlaaaLakyLksqgldvlvldld................
00457881   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00489392   2/2  -------------lsikkgklivltGppGsGKtTlakaLaerl....glpvistddllr...........
00482552   2/2  -------------everlstgipalDellgGglppgslvliaGppGsGKTtlalqlaanaalplelgklg
00503562   2/2  -------------kPydrLldivgigfltaddialalgiagdsperlllalallsellgeghlylplddl
00497572   2/2  lldlgildeseilledlenalalllsligaklvkdllllvlkylpsllslldvlrpkvdfddiileeake
00378621   1/2  ----------------------------------------------------------------------
00476652   2/2  yeplveklrpvllddlvgqeeakeallealaggrpprpvllvGppGtGKTtlaralanelgrpfvpvall
00486892   2/2  -----------------mlivltGppGsGKtTlakaLaerl...glpvidtddllreleidgtplgeeir
00462581   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00501942   2/2  --------------k...lilltGppGsGKttlaralaeel....glpfidaddllrelv..........
00403151   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------apkli.ltGppGsGKttlakaLaeel....glpfidtddllrklv.........
00409842   2/2  ---------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdpilgv...........
00483811   1/2  ----------------------------------------------------------------------
00503561   1/2  ----------------------------------------------------------------------
00494911   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00348322   2/2  ---------ilealrsgrvvllvgptGsGKTtlalalalel...ggrvlv--------------------
00453761   1/2  ----------------------------------------------------------------------
00474202   2/2  deelelleklslllveklrpvllddlvgqeeakeallealragrpghvllvGppGtGKTtlaralanelp
00493061   1/2  ----------------------------------------------------------------------
00462582   2/2  -------------------edleslllnplvkfedivpkvlddleealealaeaklpppkgvllyGppGt
00464421   1/2  ----------------------------------------------------------------------
00453762   2/2  ----vwvpdeeeglvlalvlsdgslllvkldlllllnplkllgveDla----------------------
00488191   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00515802   2/2  -----------------llIvltGppGsGKtTlaklLaerl....glpfistddllreavpggtpl.gee
00459702   2/2  ----------------MpkvillvGppGsGKTTlakaLa-------------------------------
00490531   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00471272   2/2  ksllekllellkrlslklkkglkvalvGrpgv--------------------------------------
00464592   2/2  --------------k...livltGppGsGKtTlakaLaerl....glpfistddllreavlggtplg...
00475032   2/2  ---vlsmHasanvgkkgdvalffGlSGtGKTt--------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00441252   2/2  g.flealknilkgipkknclllyGPpgtGKstlakalagllggtvlsvnnsn------------------
00469132   2/2  ----------------mmkviavtsgkgGvGKTtlaanlaaalaerGkrVllvdlDlpqpslslllglep
00444821   1/2  ----------------------------------------------------------------------
00378622   2/2  -glklllrrlslllkkglkvllvGlpgvGKst--------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00470232   2/2  lierlllrdlllelkll.kvllvGdpnvGKSt--------------------------------------
00387942   2/2  ----------------mkviavtsgkgGvGKTtlaanLaaalaerGkkVllidaDpqgpslslllglege
00469131   1/2  ----------------------------------------------------------------------
00494912   2/2  llveklrpvllddlvgqeeakeallealaagrpghvllv-------------------------------
00518512   2/2  -----------------klIvleGpsGsGKsTlaklLae-------------------------------
00463151   1/2  ----------------------------------------------------------------------
00495062   2/2  -------------dlgllliyeevllydvvprgrlivlsGP-----------------------------
00381632   2/2  ----------------grdvllaapTGsGKTlaallpilllllrgkrvl---------------------
00387941   1/2  ----------------------------------------------------------------------
00519421   1/2  ----------------------------------------------------------------------
00513312   2/2  ----------elalesgrdvllvaptGsGKTlaallpilellllrggrvl--------------------
00519422   2/2  ---------------pgglvlitGpmgsGKTtlllrllkrleeagkkvlvfkpaldtrylglvasrigls
00402382   2/2  Plsklleddlplllklrpdlfddvvgqdeaieallealrr------------------------------
00493062   2/2  -----------------mlIvltGppGsGKtTlakaLae-------------------------------
00490532   2/2  ---tlpaleseardltekarpvllddviGqeeaierllealergppgn..vLlvGppGt-----------
00464422   2/2  --------------MkkgkfIvieGpdGsGKTTlaklLa-------------------------------
00503172   2/2  --------------psgrlivltGPsGsGKsltdtlskaLle----------------------------
00387322   2/2  -glkglllrlklelkkllkillvGlpgvGKTt--------------------------------------
00463152   2/2  -----------------MkiIgltGpiGsGKsTvak----------------------------------
00381631   1/2  ----------------------------------------------------------------------
00488192   2/2  ---fllsllrrlslllkrllkvalvGlpgvGK--------------------------------------
00381512   2/2  ------------ailkgrdlllvapTGsGKTlaallpalelllkgk.rvlvlaPtrelaeqiaeelrkll
00403152   2/2  ---------------kglkivlvGdsgvGKTt--------------------------------------
00513311   1/2  ----------------------------------------------------------------------
00401212   2/2  ------------elkrglnvgivGhvgaGKSTLlnaLlgll.............................
00447402   2/2  ---------------kelkivlvGdsgvGKtt--------------------------------------
00475031   1/2  ----------------------------------------------------------------------
00414002   2/2  -------rrlllelkmllrvgivGlpNvGKST--------------------------------------
00444822   2/2  ------------elkkllkvllvGlpgvGKtt--------------------------------------


                         -         -         -         -         *         -         -:1120
query           FQDVVLFDDTVANNIRIGREGASDEEVAEAARAAHCLEFIERLPQGFDTVLGENGASLSGGERQRLSIAR
00422802   2/2  illdgldilalslaelrrrigyvfqdpalfpltvrenlalglllallllglskaeararalellellplg
00422801   1/2  ----------------------------------------------------------------------
00379582   2/2  gigyvfqdpalfpgltvrenlalglllllllllllllllllalskaearervlellelvgldtlldrlvg
00482202   2/2  yvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgletlldrlpseLSgGqrqrva
00490802   2/2  kllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll..............lllaakea
00510252   2/2  LlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll..............lllaak
00530592   2/2  kditdlslkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgletlld
00379581   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00367902   2/2  atvelifdllgllliirrlilrdgsgeilidgkdislldlrelrrligyvpqdpalfpqltvlenlllgl
00482201   1/2  ----------------------------------------------------------------------
00482262   2/2  vfqqdallpsltvlenlllgllllgellllllaakeaalralllllllgletlldrlpseLSgGqrqrva
00510251   1/2  ----------------------------------------------------------------------
00458602   2/2  vvvqevllffltllenlllglallllllvlllllllllllllaakeaalralllllllgledlldrlpse
00490801   1/2  ----------------------------------------------------------------------
00378982   2/2  rrgigyvfqdpalfpgltvrenlalglllaglskaeaaaraaellell.....glddlldrlvgeLSgGq
00509432   2/2  adrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdislldlrelrrligyvpqdpnllfql
00390412   2/2  ldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnllrrrgiglvpqehdlfp
00475892   2/2  vfqdpalfpgltvlenlllgllllglalkeaalra....lllllllgletlldrlvseLSgGqrqrvala
00475992   2/2  dlslaelrgigyvfqqdallpsltvlenlllglllagellllllaakeaalralllllllgletlldrlp
00367901   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00502742   2/2  vfqqlallpsltvlenlalgllllglskaeaaaraaellell.....gledlldrlpseLSgGqrqrval
00475991   1/2  ----------------------------------------------------------------------
00420702   2/2  lrrgigyvfqdpalfpgltvrenlalglllaglskaeararalellell.....glddlldrlvgeLSgG
00440861   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424962   2/2  rviglvfqdpplfprltvaenialgaeyf....rdegadvllladsllrlagalrevlgrlgrelSgGqk
00475891   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  fqdpalfpgltvrenlalgllllglskaeaaaralellell.....glddlldrlvgeLSgGqrqrvala
00440862   2/2  ggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlvllviddglteldlellkllk
00420701   1/2  ----------------------------------------------------------------------
00500442   2/2  fqdpalfpgltvlenlllgllllglslaeaaera....lelllllgledlldrlvseLSgGqrqrvalar
00404102   2/2  fqdpalfpgltvrenlalgll........kaeararalellell..gldelldrlvgeLSgGqrqrvala
00466972   2/2  igyvfqdpalfpgltvlenlllgllllglllllaakeaalrlellllllgletlldrlvseLSgGqrqrv
00458601   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379602   2/2  kliltledllelenlsfsyggkealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitieg
00500441   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00466932   2/2  rrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllllellallldllllllllllll
00361212   2/2  yvfqdlalfpeltvlenlalg................rarellerlglail...drlpgeLSgGqqqrva
00436072   2/2  yvfqdpalfpgltvlenlalgllllgll.....ealaralellellglgdl...drlvseLSgGqrqrva
00436511   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00436512   2/2  vlelirelelaelrrrigyvfqdpalpallrllalfpaltvaenlrfglglavlllldsatrlaqakrei
00466931   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00468692   2/2  GKttLlkllagllkpdsgeilvdGedlrelre..lrrrigyvfqdpalfpeltvlenlalgallag....
00485451   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00485452   2/2  sarelrkrig.vfqdpallphltvpenldlgllleilervlellelvgldvvlldtyph...........
00448931   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00468602   2/2  pqdvplfpsltvldnlalar......dlleaakaagydvvlidtaglld..ldrlvgelsggqkqrvaia
00485931   1/2  ----------------------------------------------------------------------
00469452   2/2  qlrrrigyvfqdpalfp..................aeellelvgledlldrlpge...........lSgG
00372302   2/2  .......rigyvfq....................................llerv..gledlldrlpstl
00426051   1/2  ----------------------------------------------------------------------
00498252   2/2  lgvvlqelllfpeltveenl....................................drlprllsggqrqr
00422142   2/2  lkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklreviltledlglsygdpealk
00426052   2/2  rliglvfqdpilfpgltvglllffldnidlgllirgdeeleaalelaglprvielllegldtlaggggvv
00422141   1/2  ----------------------------------------------------------------------
00485932   2/2  pqlpvlfprltvlenlalg..........gadlaeraeellellglegfdvvliDtagrgrrvgelsggq
00422812   2/2  ----------------------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00448932   2/2  fqdpgl...tvlenlalg............eleararellellgledydvvliDtagrlrlpselsggqk
00488521   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00367482   2/2  ..............................................rvdeiltrvglsdl...ldrglsl
00488522   2/2  yvdqeeslfpltvlenlalg.....gedveellerlgl.dlldrlph...........qlsggqrqrvai
00437982   2/2  glvfqliglfphltvlelvalglggilveevrellkel.......................lsgGqkqrv
00372301   1/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00368502   2/2  akllgapfiridgseltek.dyvGesvearlrelfeeaigyvfqdpalfpgtvlenlalgllvseligap
00530601   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00496112   2/2  gyvfqepalfpeltvlenlalgll...............................drlpgeldlSgglqr
00475372   2/2  l............................................gldvlvgarggdlsgglrqr..lar
00371632   2/2  kkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylpa.eqlkrigllfqkglpealdve
00495372   2/2  glvfqteallppltvrenlealgldlrglld...rerviellelvglee.....lldrlprelsggnqrq
00503372   2/2  iylsdlirrgagiayveqefdlfdgltvlenvllglgdeliirrrilrdgrseyllnglgvslkeliell
00532532   2/2  rkigyvfq..lfpfltvlenvalgldglvdeedleraenllalvgleeipnrypse.......lsgGqqq
00503371   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00381442   2/2  ....reeigyvfqepallpdltvlenlylglllalllaleegkivildgdreraeellell..gldadlv
00500611   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00464792   2/2  GKTtLlkllagllkpdsgeivvyg.ligerpre.vrellglllelgvlf.....................
00500612   2/2  gmvfqelgldpdltv..........arerviellelvgllelldrlpre...........lkrsggqrqr
00480472   2/2  pgiargrlklllearraaigivfqdvdllltltvaenlllgldllllellkelkydpvilllnkidlldd
00414122   2/2  vrlgigyvpqtlglfpaltvlellalall......................lredpdlilid.....sgG
00437942   2/2  ........................................................pselsggerqrvli
00495032   2/2  rlraqsl....................gldldellerllvidllelvglle.....lldrlprelsggqr
00464791   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00478412   2/2  fqdpalfplltvrengvalglllaglskaeieervdlllelvg.....lddlldrypdelsggqrqrvai
00462762   2/2  glvfqdpdllpfltvlenvllpllaaglivivdgt.lllvglrealrkll..........gl.lsgGqkq
00379262   2/2  kllgapfvevdaselteggyvgedlekrirelfqearllvfltvlenirldaseylekrvvsrligappg
00451571   1/2  ----------------------------------------------------------------------
00451572   2/2  vtqdgelllelidegilvpdeiv.iellrealeelda.d..gvildgfprllgqaelllsggkadlvifl
00475381   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00475382   2/2  lirigyvfqdyalfprltvlenvllgll.............................llgglvvildggv
00457312   2/2  rigmvfqdpalflnpgltvrenlaeplrllklgkk..llepvglpevldryphe...........lsgGq
00512892   2/2  fq.......tveellgllaelvgle.................vrgeleellktlikelsggekqrvalar
00484102   2/2  fqdvgllpvltvrenlalllrglpgysaeeleralellelagfdvilieGllelalplilelrelsdgqi
00379962   2/2  agiplvflnfaalpasllesel..............................................ls
00379961   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00490732   2/2  ............................................lgldvllgarggdlsgglrqr..lar
00496572   2/2  vfqdpllldeltvlenlalgrylhl..glilaalaagvgvvldrvg..lsdlaygfprtlsglgqrqrva
00489571   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00475522   2/2  fqdpalfplltvrenvilgllelaglskaealarvdellelvglddellldrlp.......sggqqqeil
00457311   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00368572   2/2  ildpgdgrsvrlnplaliddeedaaellralvsemgrgeddfftpaarallralilalaeepe..ptlde
00503741   1/2  ----------------------------------------------------------------------
00387202   2/2  yrlsleeallllfldeileidglllvelregigyvf----------------------------------
00368571   1/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00477972   2/2  fqsrelfpeltvagnfleg......aevrgnlygtsrerveelleagldvlldidpqglsggqkqrlala
00496571   1/2  ----------------------------------------------------------------------
00478442   2/2  fqppalfpllevrglniaevlelaglskaealkrvdlvlelvgld........drypyelsggerqrvai
00499192   2/2  fqddfylllpalevlengafll.dlllpdaldrelllelllalveglvvlldryprllsggqrqrvaia.
00489572   2/2  ...............................................................lallelr
00434402   2/2  idfqlpdal........................drellreevlellgl..gevvivdvydlsggerqr..
00533502   2/2  yvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvildrvg..lsdlaydgfprllsggg
00513251   1/2  ----------------------------------------------------------------------
00513762   2/2  dirdlidletvme.lglgpngalvfaleellttldillealelleedydyiliD....tpGgle.lrall
00404191   1/2  ----------------------------------------------------------------------
00493432   2/2  fqsgalfphlivagnllegaevhgllygtskerveealekgllvlldr..............dlsggqql
00495771   1/2  ----------------------------------------------------------------------
00503742   2/2  yvnvselldl.............................kellrlllealglpppyqlsggerlrvalae
00533501   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00464412   2/2  fqdgilfpdltvlenvalgrygll..glikealaegvivildrv..glsdla..ypgflsggeqqrvaia
00478441   1/2  ----------------------------------------------------------------------
00487022   2/2  evfqdyalfphltvlelldnvllgleirgllk...aerlervevllervgl....lldrippalsgGqgq
00392702   2/2  .................................................llgkyvgelsgglrqr..lar
00406782   2/2  ..................................................llgkyvgelsgglrqrlala
00404192   2/2  .......................................................delvsklsgglqeqr
00464411   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  lifqdfglfelldrellielllenlalglal...egvildalrrrllelldll..gldvvilegplllsg
00510562   2/2  rGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleql..rarrlgldldrlllldaltv...
00513761   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00515532   2/2  erfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenlanvpillvlnKiDll
00510561   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00513252   2/2  ............................................................gqkqrvalle
00508671   1/2  ----------------------------------------------------------------------
00444382   2/2  vlLvGppGtGKTtlakalakll..gvpfiridgselte....kelvGe......................
00508672   2/2  dlraglsiglilsdedraalrrrlgevfqelllagrlvvldgtalgl..elrdelrellkeaglpllvvf
00468951   1/2  ----------------------------------------------------------------------
00470732   2/2  l..gagfilidgddlrekavgeleklgrdlfqvaregglvpdilfideidallrkgpdvildgagrtpeq
00420082   2/2  yqlplrldlgeislddaallllslqllfaapylslnevidaarvlladefikplpagykvvi--------
00468952   2/2  prGelvlivGppGsGKTtlalqlaanlaklggkvlyid...teesldqlrarrlgldlddllllpaltve
00432181   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00489632   2/2  gfgfqqgdlledatvlenlalllldeidka........................ledggvvlldgfdrsq
00515511   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00439862   2/2  leellllgll......................................siliadplglsgeellrvllal
00477011   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00495772   2/2  NaLlgellattgeipgdggdgrhtTrdvllirle....glvliDtpGfrd--------------------
00356411   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00480252   2/2  llgvpvvgvltgldlagalrealell.................llegydvvliD....tagglqrgllla
00515512   2/2  erfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanvpillvlnKiDll
00480441   1/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00405882   2/2  ......grqlvlvDtpGlielaslgeglvr.........qalealeradvillvvdasdplldqpvells
00386741   1/2  ----------------------------------------------------------------------
00356412   2/2  frklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenvpi.........ilv
00386742   2/2  .......................................................selsggeklrgllar
00394722   2/2  .....................................................sdlvgelegglrgllte
00498532   2/2  rGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleql..rarrlgldldellllpaltveel
00402372   2/2  ..................................................fgkyvgafegglrqllglar
00420941   1/2  ----------------------------------------------------------------------
00432182   2/2  ........................................................vliDtpGleefa..
00367291   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00482722   2/2  irellgegyllpdea.lfrallaellfgdllalalldgvv...........ydrlrdellaelsggqgdv
00437922   2/2  ligevlqalglllgg.......................................................
00511382   2/2  vleavglffaldllelll....................................................
00480442   2/2  fvdrelfeelivagnlled..........aivhgllygtskerieealdaglgvlldgfprglsqaqalr
00473941   1/2  ----------------------------------------------------------------------
00477012   2/2  vflelgerldl......lglvfqdfsllpelielenralagpiagisrdairleielpglpdltlvDtPG
00527261   1/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00532472   2/2  .....................egrliglvfqdldllpllevlellaarleellerippalsggqgqrvil
00511381   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00420942   2/2  ..............................................................sellgkyv
00367292   2/2  ......................................................................
00496062   2/2  fqalllagellfddevlgll............rerldelielllaggvvildgfpldlegalllrealar
00499331   1/2  ----------------------------------------------------------------------
00515352   2/2  elfqdyllfpfltvdeni.................rglllealeellaagkvvild...glsggllqrva
00472911   1/2  ----------------------------------------------------------------------
00478082   2/2  dlleilf..............................................eglllsdefrelleeal
00437902   2/2  ...............................................vddlsgyvgelsggeklrellae
00478081   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00533152   2/2  vfqdaleaglllfddefrglller...............leellargpvvildgf....pggllqrealr
00469162   2/2  gfqdlilvpdllvlellaan............ragl.relikellaagkgvildrfplsrlayqlsgger
00516041   1/2  ----------------------------------------------------------------------
00461622   2/2  ikdyfdpgalvpd.llirlllerllfldeg..................ggflldgfprtleqaealskpa
00527262   2/2  skgyvdleellrelaeelgell................................ellkkllkklsellgl
00487062   2/2  rlirelllrlg.................................fgepdafdn.ellgellealleggki
00521551   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00499332   2/2  vfqdlllaggllvddev....................rrlllealdell.laggkvvildgfpggllqre
00496061   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00473942   2/2  ....................................pfielsasdllg.............esdlrggfk
00489391   1/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00521552   2/2  ..............................................................elvgkyvg
00472912   2/2  ........................................................gllfedaleagfrq
00515351   1/2  ----------------------------------------------------------------------
00476072   2/2  ellgegyllfdeal........................drellaallfglel.egalldglvygvlqdrl
00478132   2/2  .........ddlrreavgqlglglsieeldealllpdalrralleealealkag.dvvild.gfgrslaa
00478392   2/2  dlfdedrllfrellideidl..................................................
00416172   2/2  ............................................dlleselfghekgafgggekqrlgll
00482661   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00457852   2/2  viqdlfllgg................llffdeldellkerieellaaggvildgfpldlegaealreall
00517691   1/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00418302   2/2  ............................................................pfirvdasel
00509892   2/2  erlrrvgelalllaggglcalvaddlagaleellarala............ggpdviliE.gagl..lpl
00477562   2/2  .......................................alifqdeldlfdedreegfrvpeelvrellk
00457851   1/2  ----------------------------------------------------------------------
00430122   2/2  ekllvselig.......................................................hppg.
00516042   2/2  iielfdearelvpelallfideidell........................akgkvvild......gtgr
00487061   1/2  ----------------------------------------------------------------------
00519582   2/2  vvdli...................................................dleaverhlldiae
00477722   2/2  ielilelfd...................rarfrkllielldellaaggvvldlgrtlllrralrellrel
00478131   1/2  ----------------------------------------------------------------------
00493172   2/2  vfvsgelfkeli...........dagelledaivigllyergtlldavegalldgfpvlldgalqlllll
00486891   1/2  ----------------------------------------------------------------------
00512062   2/2  ...............gkirelfgflgelvfralelgllldeiekllakgkvvi-----------------
00457882   2/2  lqdlllag................gllpdaivrdlllelleelladgkgvildgfprdleqaealralla
00441251   1/2  ----------------------------------------------------------------------
00410532   2/2  ........................................gefv.dygptigvnfktvevdgvklviwDt
00477721   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00517692   2/2  .................................gtlllllgllsfllalvldslplerergitidvalar
00479331   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493982   2/2  .........................egigllfelaeraeflillideidklleegkvvildgtpllleal
00512061   1/2  ----------------------------------------------------------------------
00491902   2/2  edlfvprellidlikell----------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00482662   2/2  naaaflksnrqkklvrdladrviaeerlellekiieellrirldklledldeiveelppvlfddlvgqee
00518511   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00480502   2/2  ............................................idgllilfledeaalselvlevllea
00486922   2/2  fqelllegellfrdell................dlllevieellaag.gvildgfplslegaqalrallr
00483812   2/2  .....................................ellrgllgqpklydlleellellldegekipve
00457881   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00489392   2/2  ..........................................eavpggtdlgelfqdlllegellfidei
00482552   2/2  gkvlyisteeafsperlreralslgldleelldrllvidat.....................dlldllel
00503562   2/2  veellklleldelllelieleellkelleeilvellkedlelvlderrlyleeleldelglaellkelle
00497572   2/2  elllellelplklpelfkrlglkapkrrgvlLyGppGtGKTllakalakelgrl.pfirvn.........
00378621   1/2  ----------------------------------------------------------------------
00476652   2/2  cfvrvncaallelsasdll...................................................
00486892   2/2  dlllagellfraevrdll......................................yelllealeaggvv
00462581   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00501942   2/2  .......................gesirelfeaagrlaprellldeidellekggivildgfllt...lr
00403151   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00479332   2/2  ........................gesirellelagelaprillldeilellekggivlddggrnllral
00409842   2/2  ......................................................................
00483811   1/2  ----------------------------------------------------------------------
00503561   1/2  ----------------------------------------------------------------------
00494911   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00474202   2/2  rslpglpfvrvnasdltdvglleellgkllgaat....................................
00493061   1/2  ----------------------------------------------------------------------
00462582   2/2  GKTtlaralakelglpfvrinasd..............................................
00464421   1/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00515802   2/2  irdlldagellpdeelr.............................................dlllevir
00459702   2/2  ----------------------------------------------------------------------
00490531   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00464592   2/2  ................eeirdlleagallpdalvrdlllevikellaaggvv------------------
00475032   2/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00469132   2/2  eelgladlllglvdledvllktsspgldllpag.gplaglelllsealrelleelrddyDyviiDtppgl
00444821   1/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00387942   2/2  plgladllageadledailetp...egldllpaglllagl.ellrgerlrelleeladdyDvviiDtppg
00469131   1/2  ----------------------------------------------------------------------
00494912   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00381632   2/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00519421   1/2  ----------------------------------------------------------------------
00513312   2/2  ----------------------------------------------------------------------
00519422   2/2  leailvtllldlfel...................................................llrl
00402382   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00490532   2/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00381631   1/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00381512   2/2  gflgldlelkvallhg....................glslkereealedl.geadilvaTpgrlldllrd
00403152   2/2  ----------------------------------------------------------------------
00513311   1/2  ----------------------------------------------------------------------
00401212   2/2  ..................................................ldtlkgelergitikigaas
00447402   2/2  ----------------------------------------------------------------------
00475031   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           ALLKDAPVVLLDEATASLDPENETLIQRAVGTLCAGKTVIVIAHRLRTVANADKIVVLDSGRVAEEGNHK
00422802   2/2  ldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetraellellrelakgltvllvthdl
00422801   1/2  ----------------------------------------------------------------------
00379582   2/2  eLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakegltvllvthdldealrladr
00482202   2/2  lArallldpkllllDEPtsgLDpetraellellrelakgltvllvthdlsearladrilvlddGrivelg
00490802   2/2  alralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLDpetraellellrela
00510252   2/2  eaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgLDpetraellellre
00530592   2/2  rlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelakgltvllvtHdlsealla
00379581   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00367902   2/2  elrrklldellgllellalleellklleellkelevleaalaallkeeieeraeellellglgglldrpv
00482201   1/2  ----------------------------------------------------------------------
00482262   2/2  lArallldpdllllDEPtsgLDpetraellellrelakgltvllvthdlsealladrilvlddGrivelg
00510251   1/2  ----------------------------------------------------------------------
00458602   2/2  LSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtHdldealrladri
00490801   1/2  ----------------------------------------------------------------------
00378982   2/2  rqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrladrilvld
00509432   2/2  tvlenlllgpeerrelldellglellsleealaraeealeelnallkeleeeleligplldglellvgln
00390412   2/2  lltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarllelleglkeeaekaka---
00475892   2/2  rallldpkllllDEPtsgLDpetraellellrelakegltvllvthdldealrladrilvlddGrivelg
00475992   2/2  seLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvtHdlsealrlad
00367901   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00502742   2/2  ArallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrladrilvlddGrivel
00475991   1/2  ----------------------------------------------------------------------
00420702   2/2  qrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrladrilvl
00440861   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424962   2/2  qrvaiarallleragnleggGsiTalatvlveggsdpdllllDeptsalDgeivlslllalkrlyPaidv
00475891   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  rallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealaladrilvlddGrivel
00440862   2/2  elgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdpnlfpglvvlisaltgegldelt
00420701   1/2  ----------------------------------------------------------------------
00500442   2/2  allldpdllllDEPtsgLDpetraellellrelakelgltvllvthdlsealrladrilvlddGrivelg
00404102   2/2  rallllleelsldpdllllDEPtsglDpetraellellrelakegltvllvthdldealrladrilvldd
00466972   2/2  alarallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrladrilvlddGriv
00458601   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379602   2/2  pdel......lrnkigyvfQdpvlfpltvren......................................
00500441   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00466932   2/2  lllllllvlllllllllvlllllllalllllalkeaallleelllllglgdlldrpvstLSGGerqrval
00361212   2/2  iaralaldpdllllDeptsalssrssendpetvaellellkelakelgvtvilvthdldlldsallrpgk
00436072   2/2  larallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlalaladr----------
00436511   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00436512   2/2  salarellervglpgdlftllsrlderagnlSgGqrqrvaiaralasdpdllil----------------
00466931   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00468692   2/2  .................lglaeyldelgkdLSgGqrqrvalAr.....pvlLllDEptsgldalre..il
00485451   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00485452   2/2  elSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrtiilvthdlreae.a
00448931   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00468602   2/2  rala.apevllldeptsgldalae..llelleel..gltvlvvtKlDgtakgghdlslalrladrilvlg
00485931   1/2  ----------------------------------------------------------------------
00469452   2/2  qrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtvilvtH.......Asd
00372302   2/2  sgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtHdlelaalladrv
00426051   1/2  ----------------------------------------------------------------------
00498252   2/2  vvidsalalrpkllllDEPtsgldplsarellellrrllrlakelgvtvllvthdldeaealadrvlvla
00422142   2/2  dlslaippgglvlltGptGsGKtTllralagllnpdegriltiedp............ieyvfqspnlfp
00426052   2/2  lsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadteeellellerlare-------
00422141   1/2  ----------------------------------------------------------------------
00485932   2/2  kqrvaiarallllldpelllldEptsglda..lrlllellkel..gltvlvvthddgtakggaalslale
00422812   2/2  ----------------------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00448932   2/2  qrvaiaralaaplppevllldeptsglda..lrellellrel..gltvlvvthlDllakggadlslalel
00488521   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00367482   2/2  sggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellgatvlvvtHdlelaalaadr
00488522   2/2  aralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLkrlakelgvtvllvthdldevarl
00437982   2/2  aiaralagdpkvlllDEpt.aldpdaqnaLlklleelakgvtvilathdlsellpallsrcqvirfppls
00372301   1/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00368502   2/2  pgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallgggrelrdgellkalke
00530601   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00496112   2/2  qrvaia...agdpdllllDeptsalrslgndpelraellrllkrl.kelgvtvilvthdleeaedladsg
00475372   2/2  allgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdldavlkaadrilvldlggiv
00371632   2/2  ell......................ellldlkegledilvp...vlsggqkqrlalaralvedpdvlilD
00495372   2/2  rvvia.alallpkllllDEptsaldvslraeilrlLkrlakelgvtvllvthdleeveeladrvavlagg
00503372   2/2  ldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeellklleeleellkelekrlel
00532532   2/2  rv...........illldEPtsgLdpvsr.........................leladriyvllsGriv
00503371   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00381442   2/2  iilpasleellerldrrggelsggqkqRvalara------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00464792   2/2  ...........aaellervglvaatadeppgelsggqrqrlaiAraladdqgkpvllllDEptsgld---
00500612   2/2  vviDaralllrpel..lDEptsaldvslraeilrlLkrlakelgvtvllvthdlreveeladkrdrvvvl
00480472   2/2  rllrraeaeerieellelv---------------------------------------------------
00414122   2/2  qkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltvlivlnKiDllselt---
00437942   2/2  aralladpkvlllDEi.daldpeaqnaLlklleelpkgvtvilttnrleeldpallsRfdviefpppdee
00495032   2/2  qrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelgvtvilvthdlrevegrleladrvv
00464791   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00478412   2/2  aralalepelllldeptsaldplavvellelllglneeldiilalelllld-------------------
00462762   2/2  rvadlvvlldadpevllaReptrgldpeteeeleellerleereplygadiviithdlsieevadrilal
00379262   2/2  yvgyglggllteavrrlpysvllldelekahrpirvlllsaslvlllgglglpevgelllellddvgltd
00451571   1/2  ----------------------------------------------------------------------
00451572   2/2  daplevlleRllkrddekilkrleeqkqrvaiarallkkpailil-------------------------
00475381   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00475382   2/2  rqrlalarallldpdvllldeplllldaalr..........dlpdlvifldadpeelleRllkRg-----
00457312   2/2  rQRv...ralaldpdllilDeptsalgqpdpelrelldllifldadlgltlirlitrdlgeagrsadrvl
00512892   2/2  allakpdvlllDEid.gldpdvleallelleelkrsgvtvilttndldeleladriallrrgrivelgpl
00484102   2/2  qrvaparallrdpllllldedtvvldkvdlasild-----------------------------------
00379962   2/2  ggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLl------------------------
00379961   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00490732   2/2  allgdydvliiDtp.gtldvllelallellkellaelgadvvllvvdatlgleaadrilvlleglgvpgv
00496572   2/2  larallkpdlviflde......ppteeldeRlrkrlrlgdteevlehrleraeeladrlial--------
00489571   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00475522   2/2  rvaiallilpvllgralallpelllldeptsaldpdlveeilel--------------------------
00457311   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00368572   2/2  llellselg....lrdladrleklvagglagllegaektaasilellrkllallldlggpaf--------
00503741   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00477972   2/2  ralilppsllrgldep.ealdarle.raleellelaegfdvvivnhdleealelldr-------------
00496571   1/2  ----------------------------------------------------------------------
00478442   2/2  lr..vllpklllpdepgrnldvlievavlnlilkllgidallelvdr-----------------------
00499192   2/2  ....dpdvlildgptllldpe..........................lrpladlvifld-----------
00489572   2/2  ntteagaasgsrdkgllgklkpetraelldllre..egttilvvth.ldeaeraDrvavldd......Gt
00434402   2/2  .aralasgpdvlilDgptlgldv...........lldlpdlvifvdhdlevalerrlkr-----------
00533502   2/2  rqrvalaralvvkpdlvilldeplevldeRlrkrgrlelrelds...eevlekrlehylellekad----
00513251   1/2  ----------------------------------------------------------------------
00513762   2/2  alllaiaralaadeillvddptsgldaetqleilelllelllklgipiilvlnKlDllseegle------
00404191   1/2  ----------------------------------------------------------------------
00493432   2/2  rvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvivnddleealeelld
00495771   1/2  ----------------------------------------------------------------------
00503742   2/2  allalgkpdllilDEitnlldpetlspdvlelLlrlleegkltdkllgltliltthdldllerladrlls
00533501   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00464412   2/2  rallpkpdlvllldepteeldeR...llkRgrllekleyikkrlehylelaepykddvvvidang.siee
00478441   1/2  ----------------------------------------------------------------------
00487022   2/2  rvildrallselayqpdvllldeplsgldaklreelrdllrellpegilpdlvifldad-----------
00392702   2/2  allakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtviattnrpeeldpallr
00406782   2/2  ra..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvtviattndleel-----
00404192   2/2  vaiafalarkpdllllDEidalgldpelqeellelldelaergvtlilttnnrpeeldqa----------
00464411   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  glrqrpdlvifldappevlleRllkRggldeetiekrlelylelaplygaadividndlsleevvdr---
00510562   2/2  .........eellalaerll.......................sggkvdlvviDsltalapalelsllld
00513761   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00515532   2/2  eakeraeellellglgdlldklpse........lsgGqkq------------------------------
00510561   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00513252   2/2  aalkegylvvvDet..gldraqrlellelardlgrpvlviflatspevlierlldrvllldegslvdlgv
00508671   1/2  ----------------------------------------------------------------------
00444382   2/2  ..................................segailsggfkqrvgia..lladpgilflDEidkll
00508672   2/2  ldaplevlleRdrrglypeelsgglkqrvaiarplelaae------------------------------
00468951   1/2  ----------------------------------------------------------------------
00470732   2/2  lealldllee........lgrpvvviilttnrevlldral.rRpgrllldep..eldppdreerleilkr
00420082   2/2  ----------------------------------------------------------------------
00468952   2/2  ellala....................................erllsggkpqlvviDsltalrpa-----
00432181   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00489632   2/2  lqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarleeryradlvivtdd------
00515511   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00439862   2/2  alelkpdlliiDeltalldaervrelrellralkrlakelgvtvilvsqltelildalagggaleqladg
00477011   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00480252   2/2  laladlllvllldepllvld--------------------------------------------------
00515512   2/2  eaklvllllvglfdlldglpse...........lsgg---------------------------------
00480441   1/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00405882   2/2  ggekqrlalarallgkpvilvlNKiDeptneldlellellee......lggtvvlvSahdgegldelld-
00386741   1/2  ----------------------------------------------------------------------
00356412   2/2  lNKiDlleekiveellellgleykgd..rdpeelsggqkqrvala-------------------------
00386742   2/2  ala.kpgvlllDEida.ldpdvqeallelleegeltivggglltel------------------------
00394722   2/2  ala.lakpsvlflDEidrlldardsesslevlnaLlrlledg...nv-----------------------
00498532   2/2  lala....................................erllsggkpdlvviDsltalapslllldep
00402372   2/2  aa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleeg..nvr------------------------
00420941   1/2  ----------------------------------------------------------------------
00432182   2/2  sggekqrvalalallreadvlllvvdadeptsfldle...llell-------------------------
00367291   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00482722   2/2  liiegalllepgllplpdlvifldappevlleRllkRg..gdseeeiekrleryreiapll---------
00437922   2/2  .........kpdvlllDEi.drldpdaqnallklleelpagvtlilt-----------------------
00511382   2/2  ....qdpdviliDE.aqfldpevvevllelad...tgilvlvtglemdfagelfegsll-----------
00480442   2/2  laldlvllldpslevlleRllgrgddteevirkrlerl.........apeleyyeelgladvvivnddle
00473941   1/2  ----------------------------------------------------------------------
00477012   2/2  lgsvavvdqlsggqkqrvalarallknpdtlillvedandldte--------------------------
00527261   1/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00532472   2/2  drslysrpavlllllyvdeplsgldvelreelrdlleslllvlplpdlviyldadpe-------------
00511381   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00420942   2/2  gelsgglrqllalara..akpsilllDEidklapkrsptsald---------------------------
00367292   2/2  selleklvgegegrlrgalaealradpgvlflDEidalagkrgsgtsrldpe------------------
00496062   2/2  allpdl.viflda---------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00515352   2/2  llrallrpdlviflda.......pleelleRllkR...ddseeeilerleryreeleplle---------
00472911   1/2  ----------------------------------------------------------------------
00478082   2/2  alladgdvvilDgfgrlldarq.lleelllllleepppdlvifldadpevlleRllkRgrr---------
00437902   2/2  alteavlkgkpsvlllDEi.daldpdvlnallklldglrdlsgvlii-----------------------
00478081   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00533152   2/2  rlllrpdlviflda...pleelleRllkrgrlirleddseevlekrlerylklyerlie-----------
00469162   2/2  qrlaidlegalllerllldepfpdlviflda---------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00461622   2/2  vlsggrkqrlalaralavdpe.lildgrllgrrllplpdlvifldaspeelleRllkrgrer--------
00527262   2/2  silglelilglsggdleelleelaell-------------------------------------------
00487062   2/2  vlsarraqlleirlirpllaegkvvilDrepdsadlafagagyllggldleevkaleelllvlpkpdlvi
00521551   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00499332   2/2  alrrllprpdlvilldappeelleRllkrgrldgreddslellekrler.....yeeltrd---------
00496061   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00473942   2/2  qa........akpgvlflDEidrl.drevqnaLlelleelqvtilggglvvv------------------
00489391   1/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00521552   2/2  elegglrqllalaraa..npgvlflDEidklapkrsptsgldd---------------------------
00472912   2/2  rladlirallakgkvvild..gtglsreareellellkelg.pvlvifldadpevlleRllk--------
00515351   1/2  ----------------------------------------------------------------------
00476072   2/2  lerllaagpdvlildgpllldvellplpdl----------------------------------------
00478132   2/2  rq...lllellrelgrvvkpdlviflda------------------------------------------
00478392   2/2  ....llakgkvvildgtnlsealdealrrllr........................pdl-----------
00416172   2/2  rla..dggvlflDEid------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00457852   2/2  ragplpdlviflda.......pleelleRllkrgreplddteevilkrlerlrelyerl-----------
00517691   1/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00418302   2/2  teaelvGyesgarlrelfaragigllaladpgvlflDEidkll---------------------------
00509892   2/2  pliellrdlldlvvlvvldgivllvdaidrl---------------------------------------
00477562   2/2  el.larllaeggdvvilDgtnltleqre------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00430122   2/2  .yvGedelgvlfeaarkappsvlllDEidkl.dpdvlnaLlql---------------------------
00516042   2/2  lleldealellgpdlvifldap.......peelleRllkr...gldeeaieerlerlrei----------
00487061   1/2  ----------------------------------------------------------------------
00519582   2/2  ellengeilildeptvgldsk-------------------------------------------------
00477722   2/2  dl............vvfldapleelleRllk---------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00493172   2/2  relllkpdlvil......ldvslevlleRll---------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00457882   2/2  elglppdlvifl----------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00410532   2/2  aGqerfrsllarylrgadgillvvdatdglsfeevaklleellgla------------------------
00477721   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00517692   2/2  llldgrkilllDtP--------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493982   2/2  rellreld......lvvfldappeellerl----------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00482662   2/2  akeallenlklflkgpellld-------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00480502   2/2  legggnpdvvildg--------------------------------------------------------
00486922   2/2  elgldpdlvif......ldappevlleRllkrgrpddseeeilerlerlreeyeplleeyddavvvidad
00483812   2/2  liiellkdvlvsdpdviilDelpgtnlklqdletlssvaktlnfpdyvvvltvdleiilk----------
00457881   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00489392   2/2  aelllealaeaegkvvildgtg..ldieqrealrelllelprpdlvifldadpeelleR-----------
00482552   2/2  lerlrrl...........lsegkvdlvviDslallarael..ldepllgldarelrellrlLkrl-----
00503562   2/2  eleideklldkilddlegilplnpeQkea-----------------------------------------
00497572   2/2  ................------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00476652   2/2  eselfgeekeaflgallerlgklalagggtvlflDEidkl.dpdvqnaLlrl------------------
00486892   2/2  ldgfpldleqaellrellkelglppdlvifldappeelleRllkR...gdseevieerl-----------
00462581   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00501942   2/2  ellpepd......lvvfldaslevlleRllk---------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00479332   2/2  lrellspdlvif----------------------------------------------------------
00409842   2/2  vlldgrdllllDtPGlidfaseptnlldleiieallralee..ad-------------------------
00483811   1/2  ----------------------------------------------------------------------
00503561   1/2  ----------------------------------------------------------------------
00494911   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00474202   2/2  .............................fllakpgvlflDEidk-------------------------
00493061   1/2  ----------------------------------------------------------------------
00462582   2/2  ....................llvgllvgelegrlrglfteav.---------------------------
00464421   1/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00515802   2/2  ellaag.gvildgfpldleqaealrallkelglrpdlvifldaspeelleRllkr...g-----------
00459702   2/2  ----------------------------------------------------------------------
00490531   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00475032   2/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00469132   2/2  gdl-------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00387942   2/2  lgd-------------------------------------------------------------------
00469131   1/2  ----------------------------------------------------------------------
00494912   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00381632   2/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00519421   1/2  ----------------------------------------------------------------------
00513312   2/2  ----------------------------------------------------------------------
00519422   2/2  llrgdidviliDEaqfldd...elveql.rllanlgilvivaGldtdfrgelfegsaq------------
00402382   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00490532   2/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00381631   1/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00381512   2/2  .........lknldlvilDEahrlldeqrg----------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00513311   1/2  ----------------------------------------------------------------------
00401212   2/2  llldklaivsdtpgt-------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00475031   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1260
query           TLLAEDGLYARLWRLQQESSSWTVPADRGDAADVPTGR--------------------------------
00422802   2/2  s---------------------------------------------------------------------
00422801   1/2  ----------------------------------------------------------------------
00379582   2/2  ilvlddGrivelgtpeell---------------------------------------------------
00482202   2/2  tpeellenpgllytllllg---------------------------------------------------
00490802   2/2  kegktvllvtHdlsealladrilvlddGriveegtpeel-------------------------------
00510252   2/2  lakegktvllvtHdlsealladrilvlddGriveegtpee------------------------------
00530592   2/2  drilvlddGriveegtpe----------------------------------------------------
00379581   1/2  ----------------------------------------------------------------------
00530591   1/2  ----------------------------------------------------------------------
00367902   2/2  s---------------------------------------------------------------------
00482201   1/2  ----------------------------------------------------------------------
00482262   2/2  tpeellenpgllytllllss--------------------------------------------------
00510251   1/2  ----------------------------------------------------------------------
00458602   2/2  lvlddGriveegtpeellenplll----------------------------------------------
00490801   1/2  ----------------------------------------------------------------------
00378982   2/2  dGriv-----------------------------------------------------------------
00509432   2/2  glldrplselSgGek-------------------------------------------------------
00390412   2/2  ----------------------------------------------------------------------
00475892   2/2  tpeellenpgllaall------------------------------------------------------
00475992   2/2  rilvlddGriveegt-------------------------------------------------------
00367901   1/2  ----------------------------------------------------------------------
00424961   1/2  ----------------------------------------------------------------------
00502742   2/2  gtpeellenpgllytllllg--------------------------------------------------
00475991   1/2  ----------------------------------------------------------------------
00420702   2/2  ddGrivelgtpeelle------------------------------------------------------
00440861   1/2  ----------------------------------------------------------------------
00482261   1/2  ----------------------------------------------------------------------
00424962   2/2  ll--------------------------------------------------------------------
00475891   1/2  ----------------------------------------------------------------------
00509431   1/2  ----------------------------------------------------------------------
00390411   1/2  ----------------------------------------------------------------------
00378981   1/2  ----------------------------------------------------------------------
00425572   2/2  gtpee-----------------------------------------------------------------
00440862   2/2  vrenlalglrlr----------------------------------------------------------
00420701   1/2  ----------------------------------------------------------------------
00500442   2/2  tpeel-----------------------------------------------------------------
00404102   2/2  Grivelgtpeelle--------------------------------------------------------
00466972   2/2  el--------------------------------------------------------------------
00458601   1/2  ----------------------------------------------------------------------
00502741   1/2  ----------------------------------------------------------------------
00466971   1/2  ----------------------------------------------------------------------
00379602   2/2  .....-----------------------------------------------------------------
00500441   1/2  ----------------------------------------------------------------------
00404101   1/2  ----------------------------------------------------------------------
00425571   1/2  ----------------------------------------------------------------------
00466932   2/2  a---------------------------------------------------------------------
00361212   2/2  rpl-------------------------------------------------------------------
00436072   2/2  ----------------------------------------------------------------------
00436511   1/2  ----------------------------------------------------------------------
00379601   1/2  ----------------------------------------------------------------------
00361211   1/2  ----------------------------------------------------------------------
00436512   2/2  ----------------------------------------------------------------------
00466931   1/2  ----------------------------------------------------------------------
00468691   1/2  ----------------------------------------------------------------------
00468692   2/2  ellrellkelgytvll------------------------------------------------------
00485451   1/2  ----------------------------------------------------------------------
00436071   1/2  ----------------------------------------------------------------------
00468601   1/2  ----------------------------------------------------------------------
00485452   2/2  drilvlrkgdivelg-------------------------------------------------------
00448931   1/2  ----------------------------------------------------------------------
00469451   1/2  ----------------------------------------------------------------------
00468602   2/2  vGeivedgtpfe----------------------------------------------------------
00485931   1/2  ----------------------------------------------------------------------
00469452   2/2  rvlvlrdgri------------------------------------------------------------
00372302   2/2  vvln------------------------------------------------------------------
00426051   1/2  ----------------------------------------------------------------------
00498252   2/2  ggrilehg--------------------------------------------------------------
00422142   2/2  l.........------------------------------------------------------------
00426052   2/2  ----------------------------------------------------------------------
00422141   1/2  ----------------------------------------------------------------------
00485932   2/2  ladrilvlgdG-----------------------------------------------------------
00422812   2/2  ----------------------------------------------------------------------
00422811   1/2  ----------------------------------------------------------------------
00448932   2/2  adrilvlgdGei----------------------------------------------------------
00488521   1/2  ----------------------------------------------------------------------
00498251   1/2  ----------------------------------------------------------------------
00368501   1/2  ----------------------------------------------------------------------
00367481   1/2  ----------------------------------------------------------------------
00367482   2/2  ivv-------------------------------------------------------------------
00488522   2/2  adrvl-----------------------------------------------------------------
00437982   2/2  eeelleildri-----------------------------------------------------------
00372301   1/2  ----------------------------------------------------------------------
00530602   2/2  ----------------------------------------------------------------------
00475371   1/2  ----------------------------------------------------------------------
00437981   1/2  ----------------------------------------------------------------------
00371631   1/2  ----------------------------------------------------------------------
00368502   2/2  aeaeelle..llglkd------------------------------------------------------
00530601   1/2  ----------------------------------------------------------------------
00496111   1/2  ----------------------------------------------------------------------
00496112   2/2  r---------------------------------------------------------------------
00475372   2/2  lnkld..lvakgga--------------------------------------------------------
00371632   2/2  ----------------------------------------------------------------------
00495372   2/2  riveq-----------------------------------------------------------------
00503372   2/2  leke------------------------------------------------------------------
00532532   2/2  esgtt-----------------------------------------------------------------
00503371   1/2  ----------------------------------------------------------------------
00495371   1/2  ----------------------------------------------------------------------
00381442   2/2  ----------------------------------------------------------------------
00500611   1/2  ----------------------------------------------------------------------
00532531   1/2  ----------------------------------------------------------------------
00464792   2/2  ----------------------------------------------------------------------
00500612   2/2  rggri-----------------------------------------------------------------
00480472   2/2  ----------------------------------------------------------------------
00414122   2/2  ----------------------------------------------------------------------
00437942   2/2  elle------------------------------------------------------------------
00495032   2/2  vlrggrileqg-----------------------------------------------------------
00464791   1/2  ----------------------------------------------------------------------
00495031   1/2  ----------------------------------------------------------------------
00381441   1/2  ----------------------------------------------------------------------
00414121   1/2  ----------------------------------------------------------------------
00437941   1/2  ----------------------------------------------------------------------
00462761   1/2  ----------------------------------------------------------------------
00478412   2/2  ----------------------------------------------------------------------
00462762   2/2  ----------------------------------------------------------------------
00379262   2/2  llgrtvdfkntiiil-------------------------------------------------------
00451571   1/2  ----------------------------------------------------------------------
00451572   2/2  ----------------------------------------------------------------------
00475381   1/2  ----------------------------------------------------------------------
00490731   1/2  ----------------------------------------------------------------------
00480471   1/2  ----------------------------------------------------------------------
00379261   1/2  ----------------------------------------------------------------------
00475382   2/2  ----------------------------------------------------------------------
00457312   2/2  ..--------------------------------------------------------------------
00512892   2/2  seeelleilrrrln--------------------------------------------------------
00484102   2/2  ----------------------------------------------------------------------
00379962   2/2  ----------------------------------------------------------------------
00379961   1/2  ----------------------------------------------------------------------
00475521   1/2  ----------------------------------------------------------------------
00484101   1/2  ----------------------------------------------------------------------
00490732   2/2  vlNkldlvaeggaalell----------------------------------------------------
00496572   2/2  ----------------------------------------------------------------------
00489571   1/2  ----------------------------------------------------------------------
00478411   1/2  ----------------------------------------------------------------------
00475522   2/2  ----------------------------------------------------------------------
00457311   1/2  ----------------------------------------------------------------------
00470731   1/2  ----------------------------------------------------------------------
00444381   1/2  ----------------------------------------------------------------------
00387201   1/2  ----------------------------------------------------------------------
00368572   2/2  ----------------------------------------------------------------------
00503741   1/2  ----------------------------------------------------------------------
00387202   2/2  ----------------------------------------------------------------------
00368571   1/2  ----------------------------------------------------------------------
00493431   1/2  ----------------------------------------------------------------------
00512891   1/2  ----------------------------------------------------------------------
00477972   2/2  ----------------------------------------------------------------------
00496571   1/2  ----------------------------------------------------------------------
00478442   2/2  ----------------------------------------------------------------------
00499192   2/2  ----------------------------------------------------------------------
00489572   2/2  peellarpanpyvrell-----------------------------------------------------
00434402   2/2  ----------------------------------------------------------------------
00533502   2/2  ----------------------------------------------------------------------
00513251   1/2  ----------------------------------------------------------------------
00513762   2/2  ----------------------------------------------------------------------
00404191   1/2  ----------------------------------------------------------------------
00493432   2/2  iivvlllgl-------------------------------------------------------------
00495771   1/2  ----------------------------------------------------------------------
00503742   2/2  rfngkgivie------------------------------------------------------------
00533501   1/2  ----------------------------------------------------------------------
00434401   1/2  ----------------------------------------------------------------------
00499191   1/2  ----------------------------------------------------------------------
00477971   1/2  ----------------------------------------------------------------------
00406781   1/2  ----------------------------------------------------------------------
00464412   2/2  vveei-----------------------------------------------------------------
00478441   1/2  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00392702   2/2  pgrfdr----------------------------------------------------------------
00406782   2/2  ----------------------------------------------------------------------
00404192   2/2  ----------------------------------------------------------------------
00464411   1/2  ----------------------------------------------------------------------
00439861   1/2  ----------------------------------------------------------------------
00498812   2/2  ----------------------------------------------------------------------
00510562   2/2  eptsgldas-------------------------------------------------------------
00513761   1/2  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00392701   1/2  ----------------------------------------------------------------------
00515531   1/2  ----------------------------------------------------------------------
00498811   1/2  ----------------------------------------------------------------------
00515532   2/2  ----------------------------------------------------------------------
00510561   1/2  ----------------------------------------------------------------------
00394721   1/2  ----------------------------------------------------------------------
00489631   1/2  ----------------------------------------------------------------------
00513252   2/2  ledl------------------------------------------------------------------
00508671   1/2  ----------------------------------------------------------------------
00444382   2/2  ddrge-----------------------------------------------------------------
00508672   2/2  ----------------------------------------------------------------------
00468951   1/2  ----------------------------------------------------------------------
00470732   2/2  ----------------------------------------------------------------------
00420082   2/2  ----------------------------------------------------------------------
00468952   2/2  ----------------------------------------------------------------------
00432181   1/2  ----------------------------------------------------------------------
00498531   1/2  ----------------------------------------------------------------------
00489632   2/2  ----------------------------------------------------------------------
00515511   1/2  ----------------------------------------------------------------------
00532471   1/2  ----------------------------------------------------------------------
00439862   2/2  vi--------------------------------------------------------------------
00477011   1/2  ----------------------------------------------------------------------
00402371   1/2  ----------------------------------------------------------------------
00495772   2/2  ----------------------------------------------------------------------
00356411   1/2  ----------------------------------------------------------------------
00437921   1/2  ----------------------------------------------------------------------
00405881   1/2  ----------------------------------------------------------------------
00480252   2/2  ----------------------------------------------------------------------
00515512   2/2  ----------------------------------------------------------------------
00480441   1/2  ----------------------------------------------------------------------
00437901   1/2  ----------------------------------------------------------------------
00420081   1/2  ----------------------------------------------------------------------
00405882   2/2  ----------------------------------------------------------------------
00386741   1/2  ----------------------------------------------------------------------
00356412   2/2  ----------------------------------------------------------------------
00386742   2/2  ----------------------------------------------------------------------
00394722   2/2  ----------------------------------------------------------------------
00498532   2/2  grvtqgld--------------------------------------------------------------
00402372   2/2  ----------------------------------------------------------------------
00420941   1/2  ----------------------------------------------------------------------
00432182   2/2  ----------------------------------------------------------------------
00367291   1/2  ----------------------------------------------------------------------
00480251   1/2  ----------------------------------------------------------------------
00461621   1/2  ----------------------------------------------------------------------
00482722   2/2  ----------------------------------------------------------------------
00437922   2/2  ----------------------------------------------------------------------
00511382   2/2  ----------------------------------------------------------------------
00480442   2/2  ealelllai-------------------------------------------------------------
00473941   1/2  ----------------------------------------------------------------------
00477012   2/2  ----------------------------------------------------------------------
00527261   1/2  ----------------------------------------------------------------------
00482721   1/2  ----------------------------------------------------------------------
00532472   2/2  ----------------------------------------------------------------------
00511381   1/2  ----------------------------------------------------------------------
00430121   1/2  ----------------------------------------------------------------------
00533151   1/2  ----------------------------------------------------------------------
00420942   2/2  ----------------------------------------------------------------------
00367292   2/2  ----------------------------------------------------------------------
00496062   2/2  ----------------------------------------------------------------------
00499331   1/2  ----------------------------------------------------------------------
00515352   2/2  ----------------------------------------------------------------------
00472911   1/2  ----------------------------------------------------------------------
00478082   2/2  ----------------------------------------------------------------------
00437902   2/2  ----------------------------------------------------------------------
00478081   1/2  ----------------------------------------------------------------------
00478391   1/2  ----------------------------------------------------------------------
00533152   2/2  ----------------------------------------------------------------------
00469162   2/2  ----------------------------------------------------------------------
00516041   1/2  ----------------------------------------------------------------------
00461622   2/2  ----------------------------------------------------------------------
00527262   2/2  ----------------------------------------------------------------------
00487062   2/2  ----------------------------------------------------------------------
00521551   1/2  ----------------------------------------------------------------------
00418301   1/2  ----------------------------------------------------------------------
00416171   1/2  ----------------------------------------------------------------------
00509891   1/2  ----------------------------------------------------------------------
00499332   2/2  ----------------------------------------------------------------------
00496061   1/2  ----------------------------------------------------------------------
00469161   1/2  ----------------------------------------------------------------------
00476071   1/2  ----------------------------------------------------------------------
00473942   2/2  ----------------------------------------------------------------------
00489391   1/2  ----------------------------------------------------------------------
00410531   1/2  ----------------------------------------------------------------------
00521552   2/2  ----------------------------------------------------------------------
00472912   2/2  ----------------------------------------------------------------------
00515351   1/2  ----------------------------------------------------------------------
00476072   2/2  ----------------------------------------------------------------------
00478132   2/2  ----------------------------------------------------------------------
00478392   2/2  ----------------------------------------------------------------------
00416172   2/2  ----------------------------------------------------------------------
00482661   1/2  ----------------------------------------------------------------------
00497571   1/2  ----------------------------------------------------------------------
00457852   2/2  ----------------------------------------------------------------------
00517691   1/2  ----------------------------------------------------------------------
00476651   1/2  ----------------------------------------------------------------------
00493171   1/2  ----------------------------------------------------------------------
00480501   1/2  ----------------------------------------------------------------------
00471271   1/2  ----------------------------------------------------------------------
00418302   2/2  ----------------------------------------------------------------------
00509892   2/2  ----------------------------------------------------------------------
00477562   2/2  ----------------------------------------------------------------------
00457851   1/2  ----------------------------------------------------------------------
00430122   2/2  ----------------------------------------------------------------------
00516042   2/2  ----------------------------------------------------------------------
00487061   1/2  ----------------------------------------------------------------------
00519582   2/2  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00478131   1/2  ----------------------------------------------------------------------
00493172   2/2  ----------------------------------------------------------------------
00486891   1/2  ----------------------------------------------------------------------
00512062   2/2  ----------------------------------------------------------------------
00457882   2/2  ----------------------------------------------------------------------
00441251   1/2  ----------------------------------------------------------------------
00410532   2/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------
00491901   1/2  ----------------------------------------------------------------------
00482551   1/2  ----------------------------------------------------------------------
00459701   1/2  ----------------------------------------------------------------------
00517692   2/2  ----------------------------------------------------------------------
00479331   1/2  ----------------------------------------------------------------------
00409841   1/2  ----------------------------------------------------------------------
00493982   2/2  ----------------------------------------------------------------------
00512061   1/2  ----------------------------------------------------------------------
00491902   2/2  ----------------------------------------------------------------------
00477561   1/2  ----------------------------------------------------------------------
00482662   2/2  ----------------------------------------------------------------------
00518511   1/2  ----------------------------------------------------------------------
00474201   1/2  ----------------------------------------------------------------------
00519581   1/2  ----------------------------------------------------------------------
00410321   1/2  ----------------------------------------------------------------------
00410322   2/2  ----------------------------------------------------------------------
00480502   2/2  ----------------------------------------------------------------------
00486922   2/2  gsiee-----------------------------------------------------------------
00483812   2/2  ----------------------------------------------------------------------
00457881   1/2  ----------------------------------------------------------------------
00493981   1/2  ----------------------------------------------------------------------
00489392   2/2  ----------------------------------------------------------------------
00482552   2/2  ----------------------------------------------------------------------
00503562   2/2  ----------------------------------------------------------------------
00497572   2/2  ----------------------------------------------------------------------
00378621   1/2  ----------------------------------------------------------------------
00476652   2/2  ----------------------------------------------------------------------
00486892   2/2  ----------------------------------------------------------------------
00462581   1/2  ----------------------------------------------------------------------
00401211   1/2  ----------------------------------------------------------------------
00501942   2/2  ----------------------------------------------------------------------
00403151   1/2  ----------------------------------------------------------------------
00515801   1/2  ----------------------------------------------------------------------
00479332   2/2  ----------------------------------------------------------------------
00409842   2/2  ----------------------------------------------------------------------
00483811   1/2  ----------------------------------------------------------------------
00503561   1/2  ----------------------------------------------------------------------
00494911   1/2  ----------------------------------------------------------------------
00501941   1/2  ----------------------------------------------------------------------
00486921   1/2  ----------------------------------------------------------------------
00464591   1/2  ----------------------------------------------------------------------
00348322   2/2  ----------------------------------------------------------------------
00453761   1/2  ----------------------------------------------------------------------
00474202   2/2  ----------------------------------------------------------------------
00493061   1/2  ----------------------------------------------------------------------
00462582   2/2  ----------------------------------------------------------------------
00464421   1/2  ----------------------------------------------------------------------
00453762   2/2  ----------------------------------------------------------------------
00488191   1/2  ----------------------------------------------------------------------
00387321   1/2  ----------------------------------------------------------------------
00515802   2/2  ----------------------------------------------------------------------
00459702   2/2  ----------------------------------------------------------------------
00490531   1/2  ----------------------------------------------------------------------
00414001   1/2  ----------------------------------------------------------------------
00471272   2/2  ----------------------------------------------------------------------
00464592   2/2  ----------------------------------------------------------------------
00475032   2/2  ----------------------------------------------------------------------
00495061   1/2  ----------------------------------------------------------------------
00381511   1/2  ----------------------------------------------------------------------
00441252   2/2  ----------------------------------------------------------------------
00469132   2/2  ----------------------------------------------------------------------
00444821   1/2  ----------------------------------------------------------------------
00378622   2/2  ----------------------------------------------------------------------
00348321   1/2  ----------------------------------------------------------------------
00402381   1/2  ----------------------------------------------------------------------
00503171   1/2  ----------------------------------------------------------------------
00447401   1/2  ----------------------------------------------------------------------
00470231   1/2  ----------------------------------------------------------------------
00470232   2/2  ----------------------------------------------------------------------
00387942   2/2  ----------------------------------------------------------------------
00469131   1/2  ----------------------------------------------------------------------
00494912   2/2  ----------------------------------------------------------------------
00518512   2/2  ----------------------------------------------------------------------
00463151   1/2  ----------------------------------------------------------------------
00495062   2/2  ----------------------------------------------------------------------
00381632   2/2  ----------------------------------------------------------------------
00387941   1/2  ----------------------------------------------------------------------
00519421   1/2  ----------------------------------------------------------------------
00513312   2/2  ----------------------------------------------------------------------
00519422   2/2  ----------------------------------------------------------------------
00402382   2/2  ----------------------------------------------------------------------
00493062   2/2  ----------------------------------------------------------------------
00490532   2/2  ----------------------------------------------------------------------
00464422   2/2  ----------------------------------------------------------------------
00503172   2/2  ----------------------------------------------------------------------
00387322   2/2  ----------------------------------------------------------------------
00463152   2/2  ----------------------------------------------------------------------
00381631   1/2  ----------------------------------------------------------------------
00488192   2/2  ----------------------------------------------------------------------
00381512   2/2  ----------------------------------------------------------------------
00403152   2/2  ----------------------------------------------------------------------
00513311   1/2  ----------------------------------------------------------------------
00401212   2/2  ----------------------------------------------------------------------
00447402   2/2  ----------------------------------------------------------------------
00475031   1/2  ----------------------------------------------------------------------
00414002   2/2  ----------------------------------------------------------------------
00444822   2/2  ----------------------------------------------------------------------