[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV55525.1


[Show Plain Result]

## Summary of Sequence Search
   1::948
   3::665 4.8e-140 39.7% 0037568 00375681 1/1   otidylyl transferase                    
  13::665 9.5e-136 36.7% 0039071 00390711 1/1   otidylyl transferase                    
  17::664 2.9e-121 36.0% 0038403 00384031 1/1   otidylyl transferase                    
  14::664   2e-120 39.4% 0038030 00380301 1/1   otidylyl transferase                    
  49::667 6.3e-111 41.1% 0043348 00433481 1/1   otidylyl transferase                    
  48::666 6.4e-105 38.3% 0052384 00523841 1/1   otidylyl transferase                    
  48::672 1.6e-103 41.1% 0042947 00429471 1/1   otidylyl transferase                    
  26::665  7.2e-95 36.8% 0040507 00405071 1/1   otidylyl transferase                    
  20::656    2e-67 28.4% 0039171 00391711 1/1   otidylyl transferase                    
 666::943  5.8e-60 37.6% 0037566 00375661 1/1   odon-binding domain of a subclass of cl 
 205::409  4.6e-55 43.3% 0037567 00375671 1/1   /IleRS/LeuRS editing domain             
  21::735  2.5e-53 24.3% 0048275 00482751 1/1   otidylyl transferase                    
 210::404  1.6e-52 45.8% 0049869 00498691 1/1   /IleRS/LeuRS editing domain             
  44::663  2.4e-50 23.9% 0047412 00474121 1/1   otidylyl transferase                    
 208::411  3.7e-49 43.8% 0038402 00384021 1/1   /IleRS/LeuRS editing domain             
 666::922    3e-48 35.5% 0039227 00392271 1/1   odon-binding domain of a subclass of cl 
  43::679  2.2e-47 27.5% 0035691 00356911 1/1   otidylyl transferase                    
  19::718  4.2e-47 26.1% 0039322 00393221 1/1   otidylyl transferase                    
  32::254  2.4e-44 32.9% 0038263 00382631 1/2   otidylyl transferase                    
 665::851  1.4e-42 36.3% 0039069 00390691 1/1   odon-binding domain of a subclass of cl 
 390::673  5.9e-40 30.1% 0038263 00382632 2/2   otidylyl transferase                    
 666::864  1.4e-32 34.5% 0043347 00433471 1/1   odon-binding domain of a subclass of cl 
 563::747  2.5e-25 24.4% 0047114 00471142 2/2   otidylyl transferase                    
 665::817  8.1e-22 34.1% 0038401 00384011 1/1   odon-binding domain of a subclass of cl 
  53::204  2.4e-16 23.1% 0048474 00484741 1/2   otidylyl transferase                    
  26::696  6.5e-15 22.2% 0039570 00395701 1/1   otidylyl transferase                    
 324::410  1.7e-14 39.1% 0046954 00469542 2/2   /IleRS/LeuRS editing domain             
 669::792  4.4e-14 29.5% 0042946 00429461 1/1   odon-binding domain of a subclass of cl 
 566::693  5.9e-13 23.4% 0053312 00533121 1/1   otidylyl transferase                    
 568::675  2.4e-11 29.0% 0048474 00484742 2/2   otidylyl transferase                    
 563::692  0.00019 22.8% 0049118 00491181 1/1   otidylyl transferase                    
  19::195      0.1 19.6% 0047114 00471141 1/2   otidylyl transferase                    
 206::257       37 21.4% 0046954 00469541 1/2   /IleRS/LeuRS editing domain             
   1::948


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MANTYKETMNLPKTDFAMRANLPESEPKRLAKWEEEHIYEQVLEKNKDGKPFILHDGPPYANGPIHIGHA
00375681   1/1  --lalyntlnlpleefplrynlkeieekwqkyweekklfeallpllggkkkfyvtdppPypnGplHiGHa
00390711   1/1  ------------etalpkfynllliekkwqkfweekklfeaflpldpgkkkfyvttppPypnGllHiGHa
00384031   1/1  ----------------Pgfinlklieekllkiweelklfgk.lflpkgkkkvvvtfppPypnGplHiGHa
00380301   1/1  -------------ialpgfinlflieekllklweeeklfeflle...gkkkfvvtvppPypnGplHiGHa
00433481   1/1  ------------------------------------------------kkkflvtvpppyvngllHlGHa
00523841   1/1  -----------------------------------------------gkkkflitvpppyvngplHlGha
00429471   1/1  -----------------------------------------------gkkkflitvpgpyvngllHiGHa
00405071   1/1  -------------------------elklyntweekklffk....pldkkkvvvtvpgpyvngllHiGHa
00391711   1/1  -------------------ynpleieeeilkkl..............kkkkvvvvrtgpyPtGplHiGha
00375661   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00482751   1/1  --------------------gmslllklllirgllneltdekelfellegkpvrvy.cG.ptPtgplHlG
00498691   1/1  ----------------------------------------------------------------------
00474121   1/1  -------------------------------------------fppgkgkkvvversspnptgplHiGHa
00384021   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00356911   1/1  ------------------------------------------pflpgkkkkvvvefssPnptgplHiGHa
00393221   1/1  ------------------kenlelierglielwreeelfell.....ekkkvrvy.tgpdPtgslHlGhl
00382631   1/2  -------------------------------lWeeegifek..dllkgkkkfvvtrfpPsPtGyLHiGha
00390691   1/1  ----------------------------------------------------------------------
00382632   2/2  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00471142   2/2  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------tkvvvrfaPnPtGplHiG
00395701   1/1  -------------------------tvelllelierglieqltdeelldkllngkpvrlytgfdPta.gs
00469542   2/2  ----------------------------------------------------------------------
00429461   1/1  ----------------------------------------------------------------------
00533121   1/1  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00491181   1/1  ----------------------------------------------------------------------
00471141   1/2  ------------------gmsvdellelllrglyntltdekelfklleggpvrvycG.idPTgdslHlGh
00469541   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FNKILKDFVNKSHAQRGFFTPYVPGWDCHGQPIEHMVEKTLGPDKMAKIDQPTLRRLCREWAEKYVDVQR
00375681   1/1  rnyilaDvlaRylrmrGydVlfvpgwDdhGlpielraekl.gktpe.dlgreeflelcrelaeeyideik
00390711   1/1  rnyvlaDvlaRylrmrGydVlfvpgwDdhGlpielaaeklldiddkiprkelgreefgetprelaeeyia
00384031   1/1  rsailgDvlaRylrmlGydvlfvlgiddhGlpiellaek..............fgedprelaeeyieeik
00380301   1/1  rsailgDvlaRylrmlGydVlfvpgwDdhGlpiellaek.lgiklllriddlgreeflelprelaeeyid
00433481   1/1  rnayilaDvlaRylrmrGydVlfvpgtDdhGlpielkaek..............fgetpreladeyidef
00523841   1/1  rtyilaDvlaRylrmlGydvlfvpgtddhGlpielraeklgid..............preladeyiaeik
00429471   1/1  rnyilaDvlaRylrmlGydVlfvpgwDdhGlpielkaek..............fgetpreladkyiaefk
00405071   1/1  rsyilgDvlaRylrmlGydVlfvpgiddhGlpiella..............eefgelpreladeyieefk
00391711   1/1  rgallgdvlarylrmlGydvlfvlgidDtglpievkaeeegileeylgkpltgipdflgdprelaeeyid
00375661   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00482751   1/1  hartal....vlarflraGydvlflig.Dahgliidpag...............elg.lprelveenaaa
00498691   1/1  ----------------------------------------------------------------------
00474121   1/1  rsavigdalaRllralGydVlrvngvddaGtqigllaaslllrgleepedlypieylldlyvklkklaed
00384021   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00356911   1/1  rsaiigdalarllrflGydVlrvngiddwGtqiellaeslkllglellgeipeisylgeyyveiakelie
00393221   1/1  rgaikldvlara....gydvlflig.Dlhgliidpa.....................pkelvrenieeik
00382631   1/2  rnallndllarylr..GyfvlriedtD..............................pereteeyidail
00390691   1/1  ----------------------------------------------------------------------
00382632   2/2  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00471142   2/2  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00484741   1/2  harsaligdllarylr..GydvlridDtD..............................perlteeyida
00395701   1/1  lHlGh....lvpldklrrfqraghevlvliG.datgrigDpdgkiiera....................l
00469542   2/2  ----------------------------------------------------------------------
00429461   1/1  ----------------------------------------------------------------------
00533121   1/1  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00491181   1/1  ----------------------------------------------------------------------
00471141   1/2  ....lvtadvlrrflragydvillig.Dltgliddpigkratrvgld..............peelrenai
00469541   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EGFKRLGVNADWEHPYLTFTPNYEAGNVEVFKRMYLDGSVYRGRKPIHWCKRCHTALAEAEIEYSDETSP
00375681   1/1  edlkrlgisfdwdrfyaTtdpeyieavqelflkLyekGliyrgdgpvyycpscetaladreveg......
00390711   1/1  eikedlkrlgisfdwsrfyrTtdpeyieavqelflkllekgliyrgegpvnydpsdetaladaevegge.
00384031   1/1  edlkrlgisydwsreyattdpeyieavqeiflklyekGliyrgerpvnycpsdetaladaeve.......
00380301   1/1  eikedlkrlgisfdwfrpyattdpeyieavqevflkllekGliyrgerpvyydpscetaladaeve....
00433481   1/1  kedlkrlgisfdw..fyrttdpeyieavqeiflklyekgliyrgegpvnycpscetaladae........
00523841   1/1  edlkrlgisfdw..fyrttdpeyieavqeiflkLlekGliyrgegpvyycpscetaladleved......
00429471   1/1  edlkrlgi..dwdrfyrttdpeyieavqeiflkllekgliyrgegpvyydpsdetaladle.........
00405071   1/1  edlkrlgisfdwfrptatl...yieavqelflkllekglayegdgavyydp...................
00391711   1/1  eikedlkalgidpdwvsesslyksglykeiitrqseyieliqeilekllekglayekdgtvnflprckta
00375661   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------wegksp
00482751   1/1  iledlkalgi..dpdkfiitaqseileiv.eliekLlekglayealnrmvyfd.................
00498691   1/1  ---------------------------------------------------------------------e
00474121   1/1  eeleeeagefllrledgd....pkrladesieeikedlkrLgv..dfdryvresesyysgavqeviekLl
00384021   1/1  -------------------------------------------------------------------kse
00392271   1/1  ----------------------------------------------------------------------
00356911   1/1  lgkdytldpeleelareffrkleegdeeylklwqklvdrsleefkedlkrlgvkfdvyrgestlyidg..
00393221   1/1  eqllalgl..dp..........................................................
00382631   1/2  edlkwlglswdwsryyqserfdyy...qelflkLlekGlayrcfctvewlpalrtalaeagvepkyrgrs
00390691   1/1  ----------------------------------------------------------------------
00382632   2/2  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00471142   2/2  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00484741   1/2  iledlkalg..idwdeevrtqserl.dayqelfekllekGlayvcelsveflvelnlfyygrls------
00395701   1/1  ltlelvdenieyikkllakgldydgpekvtivnnsdwlsklnlidflrdlgkhvsv..............
00469542   2/2  ----------------------------------------------------------------------
00429461   1/1  ----------------------------------------------------------------------
00533121   1/1  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00491181   1/1  ----------------------------------------------------------------------
00471141   1/2  eailedlkalgidp.........gkayifnnsdylpvlsfldylrlsglvsvnrl---------------
00469541   1/2  -----------------------------------------------------------------skelk


                         -         -         -         +         -         -         -:280
query           SIFVKFKMDIMPGMFETAGAAGDAYVLIWTTTPWTLPANTAVSLAPDADYVMVQADGSNMIMARELVEQV
00375681   1/1  ......................................................................
00390711   1/1  ......................................................................
00384031   1/1  ......................................................................
00380301   1/1  ......................................................................
00433481   1/1  ......................................................................
00523841   1/1  ......................................................................
00429471   1/1  ......................................................................
00405071   1/1  ......................................................................
00391711   1/1  lgdlsvevkk............................................................
00375661   1/1  ----------------------------------------------------------------------
00375671   1/1  gvyvkfpll.....dslllllkdvylvvwTTrPeTlpgntavavnpeleyvlvlvsgellilaeellefl
00482751   1/1  ......................................................................
00498691   1/1  giyvkfplvdglll.....llgdvylvvwTTrPeTlpgntavavnpeleyvlvlvdgellilaeellekl
00474121   1/1  ekGlayekellvndgavlfrlekfgddgeledr.....................................
00384021   1/1  gvyvkfplvd...........gdeylvvwTtrPeTlpgntavavnpeheyvlvlaegellilaealleel
00392271   1/1  ----------------------------------------------------------------------
00356911   1/1  .iievvelleekgllyesdgavyfdltkfgd.......................................
00393221   1/1  ......................................................................
00382631   1/2  ...................relnlelviattrpetlegdyalrl--------------------------
00390691   1/1  ----------------------------------------------------------------------
00382632   2/2  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00471142   2/2  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  ......................................................................
00469542   2/2  ----------------------------------------------------------------------
00429461   1/1  ----------------------------------------------------------------------
00533121   1/1  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00491181   1/1  ----------------------------------------------------------------------
00471141   1/2  ----------------------------------------------------------------------
00469541   1/2  glllylrypleds..........ellvvattRPEtllgdtavavhPe-----------------------


                         -         *         -         -         -         -         +:350
query           AEIAGWESYDLVRGEDGEPVALKGREFTGLTYTCPVRQDLKGTIIYGDHVTLDSGTGAVHTAPGHGQDDY
00375681   1/1  ......................................................................
00390711   1/1  ......................................................................
00384031   1/1  ......................................................................
00380301   1/1  ......................................................................
00433481   1/1  ......................................................................
00523841   1/1  ......................................................................
00429471   1/1  ......................................................................
00405071   1/1  ......................................................................
00391711   1/1  ......................................................................
00375661   1/1  ----------------------------------------------------------------------
00375671   1/1  lkllglellelevlat.....lkggvltgllvihPl.tgreipvlladyVlldyGTGaVhiaPahdedDy
00482751   1/1  ......................................................................
00498691   1/1  lkk...........elevlatlkggvltgltvihPldlltgrevpvlladyVlldyGTGaVhtaPahged
00474121   1/1  ......................................................................
00384021   1/1  lkkllle.levlat.......lkggvltglyvihPlt.grevpvlladyVlldyGTGaVmivPahdedDy
00392271   1/1  ----------------------------------------------------------------------
00356911   1/1  ......................................................................
00393221   1/1  ......................................................................
00382631   1/2  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00382632   2/2  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00471142   2/2  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  ......................................................................
00469542   2/2  -------------------------------------------iiadeyvdlefGtGavkitpahdfnDy
00429461   1/1  ----------------------------------------------------------------------
00533121   1/1  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00491181   1/1  ----------------------------------------------------------------------
00471141   1/2  ----------------------------------------------------------------------
00469541   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LVALEFDVPLLMPVDDNGVLTDEAGPFAGLDVDEANPVIIEWLRERGTLVAQKEILHSYPHCWRCHEPVI
00375681   1/1  ..........................................................ypvcwrsgapve
00390711   1/1  .............................................................ypvcwrsgt
00384031   1/1  ..........................................................ypvcwrskgdpv
00380301   1/1  ..............................................................pvcwrsgt
00433481   1/1  ..............................................................cwrsgtpv
00523841   1/1  ...........................................................pvcwrsgapve
00429471   1/1  .............................................................cwrsgtpve
00405071   1/1  ..........................................lekegdlgdlelikldgpvcyrsgdpve
00391711   1/1  ......................................................................
00375661   1/1  ----------------------------------------------------------------------
00375671   1/1  evakkyglpiinvvdedGvltnesgefaGldvfeArkaiielLeekglllkleeyrhsy-----------
00482751   1/1  ......................................................................
00498691   1/1  Dyevakkyglpiinvvddgglfns..gefaGldvleAnkaiielLeelglllkk----------------
00474121   1/1  ......................................................................
00384021   1/1  efakkyglpiinvidddgllleealelayleegllinsgefaGldvfeArkaiielLeekg---------
00392271   1/1  ----------------------------------------------------------------------
00356911   1/1  ......................................................................
00393221   1/1  ......................................................................
00382631   1/2  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00382632   2/2  ---------------------------------------vewlpalrtalaeagvepkyrgrsrelnlel
00433471   1/1  ----------------------------------------------------------------------
00471142   2/2  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  ......................................................................
00469542   2/2  evgkrhnlplinvldedgtlnenllageyegldrfearkkivelleelgllvkvedlkls----------
00429461   1/1  ----------------------------------------------------------------------
00533121   1/1  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00491181   1/1  ----------------------------------------------------------------------
00471141   1/2  ----------------------------------------------------------------------
00469541   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           FRATDQWFVSMDKNSLRENALKAIENDVEWIPAWASNRIGSMVADRPDWCISRQRSWGVPIPVFKCAKCG
00375681   1/1  vrlteqwflklsk..lddrllkalkkge.fvpeevknrlrnwlenlrDwcisRqrpWGvpiPvwh.iedg
00390711   1/1  pvevrlteqwflklgk..ladrlleal.esgewippevvrkrllnwleglrdwciSRqryWGvpiPiwyc
00384031   1/1  elrlteqwflklsk..ladrllealee.lewrpevvrkrlewileglrdwciSRqrywGvpiPvwycesc
00380301   1/1  pvevrlteqwflklgk..ladrllealee.gervivpeevknrldnwleglrdwcisRqrywGvpiPgwh
00433481   1/1  evrlteqwflklgk..lkdrllealekle.w.pesvknrllnwlenglrdwciSRqrywGvpipvwiekd
00523841   1/1  vrlteqwflklsk..lkdkllekl.dpldfalwpesvkgellnwlenglrdwcisRqswdrywGvpiPgw
00429471   1/1  lrateqwflklgk..ladrllealeege.w.peevrnrldnwlekglkdwcisrqrlywGvpiPgw....
00405071   1/1  lkltpqwfv................................llkglkdwaisRqrpwGvpiPgwhi....
00391711   1/1  ......................................................................
00375661   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00482751   1/1  ......................................................................
00498691   1/1  ----------------------------------------------------------------------
00474121   1/1  ...........................vllksdGtptyl...............................
00384021   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00356911   1/1  ......................................................................
00393221   1/1  ..............................................ekwtifrqsdwgeyiellldlgkl
00382631   1/2  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00382632   2/2  viattrpetlegdyalrl.................kidlesglenlrDwvisrqrywghdipllrs....
00433471   1/1  ----------------------------------------------------------------------
00471142   2/2  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  ......................................................................
00469542   2/2  ----------------------------------------------------------------------
00429461   1/1  ----------------------------------------------------------------------
00533121   1/1  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00491181   1/1  ----------------------------------------------------------------------
00471141   1/2  ----------------------------------------------------------------------
00469541   1/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           STVANEQTFDAVIDLFYREGADAWFTREPSEYLPRGVKCETCGCTELTPEKDILDVWWESGVSHTSVLKH
00375681   1/1  aivyvaediaylllkaieggtdllltlelldllvlyyvllgklglelkretdvldvWfdSglyylavlgy
00390711   1/1  edlgdvv....vieavlelvdpldfvlwksddlgeplwdlvvlcpkcglelkrdtdvldvWfdSglgylg
00384031   1/1  liesvydellpvvlgeleeggllleadgdllsllgdlkdfvllksdgpleretdvldvWfdSgwgylrvl
00380301   1/1  iedgamvvv...................llgdgavllpt..ytfgddg.dlvlresdvldtwfdsglyyl
00433481   1/1  dgkviyvwf..dalvgyp.....................tglgrpgekleretdvldtwfdsg.......
00523841   1/1  .......................................................etdvldvWfdsslmy
00429471   1/1  ...................................................ekdvldvwfdsgiyyiecl
00405071   1/1  ...................................................dvldvwfdsl.........
00391711   1/1  wgdgiplykak......................................................diadv
00375661   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00482751   1/1  ......................................................dvvdvwfdgwsiglf.
00498691   1/1  ----------------------------------------------------------------------
00474121   1/1  .............lrDlaisrqrfwghpipgwespwg.................................
00384021   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00356911   1/1  ...................dlrdwvisrs.........................................
00393221   1/1  t.........................................tvgellrrddvkdrw.dssisfgllgYp
00382631   1/2  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00382632   2/2  ...................................................dglptyflavvvdda....
00433471   1/1  ----------------------------------------------------------------------
00471142   2/2  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  ......................................................................
00469542   2/2  ----------------------------------------------------------------------
00429461   1/1  ----------------------------------------------------------------------
00533121   1/1  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00491181   1/1  ----------------------------------------------------------------------
00471141   1/2  ----------------------------------------------------------------------
00469541   1/2  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           REAEGLRFPADMYLEGSDQHRGWFQSSLLTSMGAYGVPPYKAVMHCGFTVDGEGRKMSKSLGNGVDPAEV
00375681   1/1  p..felgypadihvgGkDiiffhfarllaaslalfgkpppknvlhhglvldldgeKMSKSlGnvidprdl
00390711   1/1  rlgwpiecsamfekylpvdihvgGkDiirfhllyslalllalfgkpppknvlvhglvldldgeKMSKSlg
00384031   1/1  gyptedlayileklerwfpvdiyvgGkDhirfHflyllavlralgdlglltgkePfknvlthGlvldell
00380301   1/1  stldlavdkekfellfpvdiyvgGkDliffhflrllailealggkapfkevlhhglvldldgeKMSKSlG
00433481   1/1  ........wypadihvgGkDiirfhllyspaillaarmlgllleltgleppknvlvhgfvll.dgeKMSK
00523841   1/1  laylgapledlfelwwpadihvgGkDliffhllrlialllalgge.pfknvlvhglvldldgeKMSKSlg
00429471   1/1  aapllklgdkedfekwwpadgvdelihvgGkDliffhllyslaillal.gleppknvllhgfvll.dgeK
00405071   1/1  ......glpvdihvgGkDliffhllyeiailealfgleppkyvlhhgf.ldldgeKMSKSlGnvitprdl
00391711   1/1  wfdspwgygrpgyplecaaddlllgvdivlgGkDhifphllylpaqrealealgleppkvllyhgvvlgl
00375661   1/1  ----------------------------------------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00482751   1/1  ypllqaadilllgadivlgGkDq.ffhlelgralaral.gl.pfpevlthplllgldGeKMSKSlgnsvi
00498691   1/1  ----------------------------------------------------------------------
00474121   1/1  ...................dvlptwfiellayvvdd.......lgfdvdiyvvGadhi.lhferlraile
00384021   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00356911   1/1  ..........................dggytYftsdiayaly....rferlgfdkdiyvvgadqllhfaq
00393221   1/1  llqaadilllgvdivpgGkDq...wphhelgreiar....pfpvllthplllgldGveKMSKSkgnvitl
00382631   1/2  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00382632   2/2  ......llgithvlrGaDhlfntlryillleal..gl.pfpkvlhhglvldldgekmSKskgnvvvpldl
00433471   1/1  ----------------------------------------------------------------------
00471142   2/2  --adilhlgadivlgGkDq.fphhelgralaralggkpp..yvlhhplllgldGteKMSKSlgnaitldd
00384011   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  nrmlarddfalrledgislgeflYpllqayDflhlec...gygvdlqigGsDq.fpnillgrdllrallg
00469542   2/2  ----------------------------------------------------------------------
00429461   1/1  ----------------------------------------------------------------------
00533121   1/1  -----lgegadivpgGsDql.phheleralara.lgkkfpvywlhlplltgldGeKMSKSlgnaitldd.
00484742   2/2  -------lgidivvrGkDllfphalyeall..ealglpppeyvhhglv.lnldgeKmSK..Gn.vtl..l
00491181   1/1  --aDilhlelsallkadgdlldlvpgGsDQ.rphielgrdlarrlnlpep..yilttplltgldgpteKM
00471141   1/2  ----------------------------------------------------------------------
00469541   1/2  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           MAKSGADVLRLWVASVDYSQDVSISDEILQRTSEAYRRIRNTFRFLLGSLDDFDDQKDAVSDWNALEPLD
00375681   1/1  lekygadalRlfllsapygsdldfseellegavnf-----------------------------------
00390711   1/1  nvidpldllekygaDalRlfllsaapygsdldfse-----------------------------------
00384031   1/1  ltlllctleflrgrelygyvlrllallkalglel------------------------------------
00380301   1/1  nvvtpddllekygadalRlfllslapygsdldfs------------------------------------
00433481   1/1  SlgnvidpldlldkygadalRlyllslapygsdldfs---------------------------------
00523841   1/1  nvvdprdllegygadalRlyllslapygsdldfsee----------------------------------
00429471   1/1  MSKSlGnvitpddllekygadalRlfllsalapygsdldfse----------------------------
00405071   1/1  leeygadalRlfllsasyrsdldfseelllgavnf-----------------------------------
00391711   1/1  dgeKMSKSkGnvitlddllegygpda--------------------------------------------
00375661   1/1  -----------------------------------ynklwnalrFllgnlddfdpeedlldv.eelsllD
00375671   1/1  ----------------------------------------------------------------------
00482751   1/1  tlldlleeygadilryfllsgnyrdddvldfselilflaldllnklrnalrfgplllealeel..aeeyt
00498691   1/1  ----------------------------------------------------------------------
00474121   1/1  algllplapppehlhfglvll.dgkkmSkrkGn-------------------------------------
00384021   1/1  ----------------------------------------------------------------------
00392271   1/1  -----------------------------------ynklwnaarFllrnldgfdp......dleelslld
00356911   1/1  ..lfaalaalgyepakkvlhvgfvlv..g.kMSkrkGnvvtlddlleey---------------------
00393221   1/1  ddlleeiakkikkaftdprevygadalryfllsglpdkdvvfllelltelsldeleelenayrsgelnpg
00382631   1/2  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------fynklwnalrFllrnlnlfdklldgalpleelslld
00382632   2/2  idgygdprlptlaglrrrGyladalrlflallgpsksdlnfdl---------------------------
00433471   1/1  -----------------------------------anklgNllnRtlrfilknldgfvp......dleel
00471142   2/2  llekigpkilryydallsthyrlpldfsleellelldlllrlknarlaqlrlayelgklvhgelkaa.la
00384011   1/1  ----------------------------------Flnklwnlvrfllenldgfdplldl....eelslld
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  l.pkpvglttplllgldGeKMSKSlgnaiwlddllksiykkiqkalnvydadvlrylllftfl...----
00469542   2/2  ----------------------------------------------------------------------
00429461   1/1  --------------------------------------lnRtlsfilkyfdgvvpa..........teld
00533121   1/1  .ektipekirkallssgdrdvlnllklllflaleelerlraeylggkgpgeakkllaeeltel-------
00484742   2/2  ldegygpdalryfllrlgyssdldfslealeeavnlafklgnlak-------------------------
00491181   1/1  SKSlgnsaIfllddpeeikkkilkfaf..tdpnpllefsrnllgdp..dvsnllelltfllg--------
00471141   1/2  ----------------------------------------------------------------------
00469541   1/2  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           QWAMVRTKHLLDDVSAAYDAYKFHYVYRAVYDYIVNDLSAVYMDATKDRLYSEAPDSPRRRAVQTVLMNI
00375681   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00384031   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------
00523841   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00375661   1/1  rwilsrlnelikevteayenyefntalsalynfvwndlsdwYleliKdrlygdaadsaarrsaqtvlyev
00375671   1/1  ----------------------------------------------------------------------
00482751   1/1  sgvlgdgelkkalaealnellkpirealeelefdk-----------------------------------
00498691   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00384021   1/1  ----------------------------------------------------------------------
00392271   1/1  rwilsrlnelikevteayekyrfntalsalyefvwndlsdwYlelikprlyae......drsaqtvlyev
00356911   1/1  ----------------------------------------------------------------------
00393221   1/1  d................l----------------------------------------------------
00382631   1/2  ----------------------------------------------------------------------
00390691   1/1  rwilsrlnelikevteayenyrfntavaalyefvnddlsnwYlelikdrlyge.adsearraaltvlyev
00382632   2/2  ----------------------------------------------------------------------
00433471   1/1  teldrwllsrlnelikevteayenyefnkalraimelvn..lanwYldlskpwllake.dserlravlyv
00471142   2/2  ellnellaplrelleelledlellleilelga...............-----------------------
00384011   1/1  rwllsklnetikkvtealekyrfntaisalmefvn.alsdwylelakdr................vllea
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  ----------------------------------------------------------------------
00469542   2/2  ----------------------------------------------------------------------
00429461   1/1  rellallnelleevaeayenlefskaleeimelas..laNkYidetkPWklakddpdlerlaavlyvlle
00533121   1/1  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00491181   1/1  ----------------------------------------------------------------------
00471141   1/2  ----------------------------------------------------------------------
00469541   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LEVLVRVLAPVLSFTTDEVWEHYPQAMRERAGRPTNVQLAGWPKASDFAPAIPADGERVSEDFGVIMGVR
00375681   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00384031   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------
00523841   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00375661   1/1  letllrllaPflPfiaEeiWqrlpg......leeesvhladwpevdela.......elideeleelmelv
00375671   1/1  ----------------------------------------------------------------------
00482751   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00384021   1/1  ----------------------------------------------------------------------
00392271   1/1  letllrllaPflPfiaeelwqrlgg........eesvhladwpev..........de.ldelleeevelv
00356911   1/1  ----------------------------------------------------------------------
00393221   1/1  ----------------------------------------------------------------------
00382631   1/2  ----------------------------------------------------------------------
00390691   1/1  letllrllaPflPfiaeelWqrlplllg..lggeesvhlaswPevdeall.....deeledevelvvqvi
00382632   2/2  ----------------------------------------------------------------------
00433471   1/1  llevlrillillaPflPfiaeeiwqql........gleesvhlaswp.....lldghkigkpeplferle
00471142   2/2  ----------------------------------------------------------------------
00384011   1/1  letllrllaPfaPhiaeelWqll........gg.gsvllapwPevde-----------------------
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  ----------------------------------------------------------------------
00469542   2/2  ----------------------------------------------------------------------
00429461   1/1  llrllaillaPilPflaeeild------------------------------------------------
00533121   1/1  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00491181   1/1  ----------------------------------------------------------------------
00471141   1/2  ----------------------------------------------------------------------
00469541   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           EVVTKALEDARGQKVVNKSQEAAVVVTAPRAVLDAVERYDAAVFEELFIVASVSFAEGEELAATVSKTEA
00375681   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00384031   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------
00523841   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00375661   1/1  revikairslrkeknikpslplkvtiyaddeellellelle.dllkellnvssveilekaeekvivvpgl
00375671   1/1  ----------------------------------------------------------------------
00482751   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00384021   1/1  ----------------------------------------------------------------------
00392271   1/1  vqvigklrslraelnipkslplevliaaad...ellkklld.glkellnvskvivvpgklvnivv.....
00356911   1/1  ----------------------------------------------------------------------
00393221   1/1  ----------------------------------------------------------------------
00382631   1/2  ----------------------------------------------------------------------
00390691   1/1  gkvrslreear-----------------------------------------------------------
00382632   2/2  ----------------------------------------------------------------------
00433471   1/1  deeleelieqlkgliravrkaree----------------------------------------------
00471142   2/2  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  ----------------------------------------------------------------------
00469542   2/2  ----------------------------------------------------------------------
00429461   1/1  ----------------------------------------------------------------------
00533121   1/1  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00491181   1/1  ----------------------------------------------------------------------
00471141   1/2  ----------------------------------------------------------------------
00469541   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           EKCPRCWNHRALGGNANHGSVCERCGDALDAIGFAEGE--------------------------------
00375681   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00384031   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------
00523841   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00375661   1/1  lvnvvkaegekcercwkylldlgglidldalck-------------------------------------
00375671   1/1  ----------------------------------------------------------------------
00482751   1/1  ----------------------------------------------------------------------
00498691   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00384021   1/1  ----------------------------------------------------------------------
00392271   1/1  ekcercwplggl----------------------------------------------------------
00356911   1/1  ----------------------------------------------------------------------
00393221   1/1  ----------------------------------------------------------------------
00382631   1/2  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00382632   2/2  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00471142   2/2  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------
00484741   1/2  ----------------------------------------------------------------------
00395701   1/1  ----------------------------------------------------------------------
00469542   2/2  ----------------------------------------------------------------------
00429461   1/1  ----------------------------------------------------------------------
00533121   1/1  ----------------------------------------------------------------------
00484742   2/2  ----------------------------------------------------------------------
00491181   1/1  ----------------------------------------------------------------------
00471141   1/2  ----------------------------------------------------------------------
00469541   1/2  ----------------------------------------------------------------------