[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV55587.1


[Show Plain Result]

## Summary of Sequence Search
   1::352
   4::268  3.6e-73 32.6% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
   2::268  8.5e-73 32.3% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
   2::269  3.2e-67 31.1% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
   5::269  5.5e-67 32.7% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
  36::273  2.1e-51 35.1% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
  36::271  4.2e-45 32.7% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
  33::288  4.6e-44 31.7% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  40::270    5e-41 29.3% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
  36::270  5.5e-37 30.6% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
  20::273  7.8e-36 30.9% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
  39::207  1.9e-35 37.8% 0043648 00436481 1/1   p containing nucleoside triphosphate hy 
  39::207    1e-31 39.2% 0037818 00378181 1/1   p containing nucleoside triphosphate hy 
  36::279    8e-21 25.0% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
 269::328  1.7e-20 58.3% 0049854 00498541 1/1   protein, C-terminal domain              
 269::328  2.1e-20 60.0% 0049826 00498261 1/1   protein, C-terminal domain              
 269::328  2.2e-20 58.3% 0046896 00468961 1/1   protein, C-terminal domain              
 270::328  1.8e-19 59.3% 0051057 00510571 1/1   protein, C-terminal domain              
  56::226  4.1e-15 24.7% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  54::194  4.9e-15 23.7% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
  58::164  6.6e-14 30.9% 0050906 00509061 1/1   p containing nucleoside triphosphate hy 
  58::160  2.5e-13 30.1% 0041834 00418341 1/1   p containing nucleoside triphosphate hy 
  56::226  2.5e-12 21.0% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
  54::250  1.4e-11 26.8% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
  36::214  1.8e-10 26.1% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
  36::268  1.1e-08 17.9% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
  56::169  1.3e-07 23.4% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
  56::193  4.2e-07 24.4% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
  58::144  8.2e-07 26.4% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
  55::199    5e-06 25.6% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  54::199  6.5e-06 28.0% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  54::220  1.1e-05 30.8% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
  56::193  2.4e-05 19.6% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
  60::192  3.1e-05 27.5% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  57::94   3.5e-05 34.2% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
  58::159  5.7e-05 29.6% 0051942 00519421 1/1   p containing nucleoside triphosphate hy 
  57::144   0.0001 24.4% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  56::113  0.00015 28.1% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
  57::144  0.00021 23.3% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
  54::192  0.00022 24.8% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  59::149  0.00024 30.5% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
  58::144  0.00028 29.9% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
  60::235  0.00069 19.7% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  58::174  0.00078 23.6% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
  58::176  0.00091 23.7% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  55::94   0.00099 32.5% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
   1::352


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNEEKSKMLKLTTDQIETKFGKGSIMKFGEGGHDLNIGVIPTGALPLDAALGIGGVPRGRIVEVYGPESS
00468951   1/1  ---lnvlgesidalgkilseilkllekgfltalgllerk.sverlstgikaLDlllgiGglprGelvliv
00498531   1/1  -ldklgkildlalkileksflklevlalgvl.erkeverlstGikaLDallgiGglprGsltliaGppGs
00510561   1/1  -ldglgepldgllpilaklfrpievlalgl.lerksverlstGikaLDlllgiGglprGelvliaGppGs
00498251   1/1  ----vekllglalllieklflkvlprllsl.lelenlskiytgipaldvslglgGlppGeivlllGpsGs
00482551   1/1  -----------------------------------everlstgipalDellg.GglppgslvliaGppGs
00495031   1/1  -----------------------------------lsalellleledltkistgipaLddvls.ggipkG
00439861   1/1  --------------------------------kleeveristgipeldellg.GglpkgslilitGppGs
00488521   1/1  ---------------------------------------lllllalelllevenlristgikeldklls.
00495371   1/1  -----------------------------------esalellleledltklstgikaLddvlg.gglpkG
00500611   1/1  -------------------pgllsllelllele..nltklptgipaLddvlg.ggipkGeivllvGpsGs
00436481   1/1  --------------------------------------plstGiralDlllpig...rGqrilifGppgt
00378181   1/1  --------------------------------------plstgirviDlllpig...rGqrilifGpsgt
00496111   1/1  -----------------------------------elenltklytgikaLddlls.lgippGeivllvGp
00498541   1/1  ----------------------------------------------------------------------
00498261   1/1  ----------------------------------------------------------------------
00468961   1/1  ----------------------------------------------------------------------
00510571   1/1  ----------------------------------------------------------------------
00490731   1/1  -------------------------------------------------------dvslsvkkgkvialv
00448931   1/1  -----------------------------------------------------Lddvslsvepgevialv
00509061   1/1  ---------------------------------------------------------mGkleviyGpmfs
00418341   1/1  ---------------------------------------------------------lgalsElllpgeg
00475371   1/1  -------------------------------------------------------ikkgevialvGkgGv
00485931   1/1  -----------------------------------------------------LsvpkgevvalvGpnGa
00469451   1/1  -----------------------------------allelenlskiyggvpkalddvsl..giepGeiva
00361211   1/1  -----------------------------------plellgepllelenlsksyggitaldd.vs.lgir
00434401   1/1  -------------------------------------------------------vkkgliigitGpsGs
00468601   1/1  -------------------------------------------------------vkkgevialvGpnGv
00484101   1/1  ---------------------------------------------------------kgpvigivGpsGs
00367291   1/1  ------------------------------------------------------glrpgrnvllyGppGt
00437901   1/1  -----------------------------------------------------lgirpgrillLyGppGv
00404191   1/1  -----------------------------------------------------lgikpgeivllyGppGt
00480251   1/1  -------------------------------------------------------Edlslavgkgkvial
00513761   1/1  -----------------------------------------------------------kiiaivGkgGs
00475381   1/1  --------------------------------------------------------mkgeiialtGpsGs
00519421   1/1  ---------------------------------------------------------pgglvlitGpmgs
00503741   1/1  --------------------------------------------------------fifldlrplallpl
00464411   1/1  -------------------------------------------------------vkkgeiivllGpsGs
00477561   1/1  --------------------------------------------------------kkpkvillvGppGs
00406781   1/1  -----------------------------------------------------lgippgknvllvGppGt
00509891   1/1  ----------------------------------------------------------pkvigitGpsGs
00478131   1/1  ---------------------------------------------------------kgkvivltGppGs
00512891   1/1  -----------------------------------------------------------evilltGppGv
00499191   1/1  ---------------------------------------------------------kgkiigitGpsGs
00487061   1/1  ---------------------------------------------------------ldMkkgklIvieG
00422141   1/1  ------------------------------------------------------aippgglvlltGptGs


                         -         -         *         -         -         -         -:140
query           GKTTLALQIIAEAQAMGGIVAFIDAEHALDPVYAARLGVDIDEVLISQPDTGEQALEICDMLVRSGAIDA
00468951   1/1  GppGsGKTtlalqlaanlaklggkvlyidteesldqlrarrlgldlddllllpaltveellalaerllsg
00498531   1/1  GKTtlalqlaanlaklggkvlyisteesleqlrarrlgldldellllpaltveellalaerllsggkpdl
00510561   1/1  GKTtlalqlaanlaaqggkvlyisteesleqlrarrlgldldrlllldaltveellalaerllsggkvdl
00498251   1/1  GKTtLalrllagllkpgggvvyidgeesldllrarrlgvvlqelllfpeltveenldrlprllsggqrqr
00482551   1/1  GKTtlalqlaanaalplelgklggkvlyisteeafsperlreralslgldleelldrllvidatdlldll
00495031   1/1  elvllvGpsGsGKTtlllqlagllalglgliplggkvlyigleltlsperlrlraqslgldldellerll
00439861   1/1  GKTtlalqlaanlaknggkvlyisleesreqlleraerlgldleellllgllsiliadplglsgeellrv
00488521   1/1  gglppgeitlivGpsGsGKTtLllqlavngllppdsGeiggkvlyvdqeeslfpltvlenlalggedvee
00495371   1/1  eivlllGpsGsGKttlalrllagllkpevlvdgldltglsparggiglvfqteallppltvrenlealgl
00500611   1/1  GKTtlllqlagllapdsgeillggkvlyisleeslrrrrigmvfqelgldpdltvarerviellelvgll
00436481   1/1  GKTtlalqiianaaknggvvvyvligerlrevtelleeleelgalkrtvvvaatadepalarllaaetal
00378181   1/1  GKTtlalqiianaqkeggvvvyvligergrevtefaeelldlgalkrtvvvaatadepallrllaaetal
00496111   1/1  sGsGKTtlalrllagllkptggkvliiglelsaeelrerrrrigyvfqepalfpeltvlenlalglldrl
00498541   1/1  ----------------------------------------------------------------------
00498261   1/1  ----------------------------------------------------------------------
00468961   1/1  ----------------------------------------------------------------------
00510571   1/1  ----------------------------------------------------------------------
00490731   1/1  GkgGvGKTTlaaklagllakrggkvllidaDpyrpaadellgvlaeelgldvllgarggdlsgglrqr.l
00448931   1/1  GpnGsGKTTllnalagllapdggkvllvgadiarla.areqlgivfqdpgltvlenlalgeleararell
00509061   1/1  GKttellrrlaryeiaglkvlvi..kpalDtry........sglvvsrlglsleallvsslldllellgd
00418341   1/1  agelalllplLaqllaqregrwvllvappallsapalaaaGldldrlllvrasdeedalwaaeeaLrsga
00475371   1/1  GKTTlaanlagllaptggkvlligaDirrpsarellgllgellgldvlvgarggdlsgglrqr.laral.
00485931   1/1  GKTTllallagllaptggkvllvgadirrigavpqlpvlfprltv.lenlalggadlaeraeellell.g
00469451   1/1  lvGpsGsGKstllrllagllaglptsGeillldgkdvlylsleesleq.lrrrigyvfqdpalfpaeell
00361211   1/1  kGeivllvGpsGsGKStllrnllagllaptggsvlldgleisalslaerlragigyvfqdlalfpeltvl
00434401   1/1  GKTTlaraLaellrerggsvavidlddfyrpaaelllreglgidfqlpdaldrellreevlellglgevv
00468601   1/1  GKTTllakLagllapqggkvlllgaDiyraaaaerlgigavpqdvplfpsltvldnlalardlleaakaa
00484101   1/1  GKTTllraLagllkprggrvavigldigrldldellgigylfqdvgllpvltvrenlalllrglpgysae
00367291   1/1  GKTtlaralanel...gapfirvdaselleklvg...............egegrlrgalaealradp.gv
00437901   1/1  GKTtlakalakel...gapvieidaselrdvddlsg........yvgelsggeklrellaealteavlkg
00404191   1/1  GKTtlakalanelkkrggrvlyvsa................delvsklsgglqeqrvaiafalark..pd
00480251   1/1  vGkgGvGKTTtaakLaaalaergkkvllidlDpyrpsapeqlgilgellgvpvvgvltgldlagalreal
00513761   1/1  GKTTllnklaglla.dggkvlvidlDpar.anlpeqlgidirdlidletvmelglgpngalvfaleellt
00475381   1/1  GKsTlarlLagllkptsgivsvdg----------------------------------------------
00519421   1/1  GKTtlllrllkrleeagkkvlvf..kpaldtryl.glvasriglslea.ilvtllldlfelllrlllrgd
00503741   1/1  pdrlvgrdeeiealskalggaldgvslsiepggivllvGppGvGKTtLakllagllkpkfgeillfgkvv
00464411   1/1  GKsTlaklLagllgptggsv.lltgepvsgeplgeligevfqd---------------------------
00477561   1/1  GKtTlaraLakrlaelgkgvvvidtddlrralifqd.eldlfdedreegfrvpeelvrellkellarlla
00406781   1/1  GKTtlakalagelgvpfvrisa...................sellgkyvgelsgglrqrlalaraadpgv
00509891   1/1  GKTTlanaLarllkarglkvavidrdpgrld.........ldeplgvdrerlrrvgelalllaggglcal
00478131   1/1  GKtTlarlLaellkplglgvvvidg....ddlrreavgqlglglsieeldealllpdalrralleealea
00512891   1/1  GKTTlakalagelgakfgsvsltgrdv.....rsarrgigyvfqtveellgllaelvglevrgeleellk
00499191   1/1  GKsTlaklLaellgatvgdvd...........gllvgvvfqddfylllpalevlengaflldlllpdald
00487061   1/1  ppGsGKtTlakaLaer.gargldvvviyepvdywaavgggdllrlirelllrlgfgepdafdnellgell
00422141   1/1  GKtTllralagllnpdegriltie----------------------------------------------


                         +         -         -         -         -         *         -:210
query           VVVDSVAALVPRAEIEGEIGDTTVGLQARLMSQALRKLAGSLSKSNTTCIFINQLREKIGVMFGNPETTT
00468951   1/1  gkpqlvviDsltalrpalllldeptgellgldvrllsellrllkrlakelgvtvilvshvlkegedradd
00498531   1/1  vviDsltalapslllldepgrvtqgldarllreilrllkrlakelgitvlltshvtrevedraddvpvla
00510561   1/1  vviDsltalapalelsllldeptsgldasllreilrllkrlakelgvtvllvshvlkevedladpvpdlr
00498251   1/1  vvidsalalrpkllllDEPtsgldplsarellellrrllrlakelgvtvllvthdldeaealadrvlvla
00482551   1/1  ellerlrrllsegkvdlvviDslallar.ael...ldepllgldarelrellrlLkrlakelgvtvilts
00495031   1/1  vidllelvgllelldrlprelsggqrqrvviDalalll.rpell...DeptsaldvqlvaeilrlLkrla
00439861   1/1  llalalelkpdlliiDeltalld.............aervrelrellralkrlakelgvtvilvsqltel
00488521   1/1  llerlgldlldrlphqlsggqrqrvaiaralaeelkpdllvlDeitalfr....aelegrptsaldvsll
00495371   1/1  dlrglldrerviellelvgleelldrlprelsggnqrqrvvia.alallpklll...lDEptsaldvslr
00500611   1/1  elldrlprelkrsggqrqrvviDar.alllrpel...lDEptsaldvslraeilrlLkrlakelgvtvll
00436481   1/1  tiaeylrdsgkdvllvlDs...............ltrlalalreislalgelpgregypptlfills---
00378181   1/1  tiaeylrdsgkdvllvldsl...............trlalalrevslalgelpgregypgtlfslls---
00496111   1/1  pgeldlSgglqrqrvaiaagdpdllllDeptsalr...........slgndpelraellrllkrl.kelg
00498541   1/1  ----------------------------------------------------------------------
00498261   1/1  ----------------------------------------------------------------------
00468961   1/1  ----------------------------------------------------------------------
00510571   1/1  ----------------------------------------------------------------------
00490731   1/1  arall..gdydvliiDtpgtldvllelallellkellaelgadvvllvvdatlgleaadrilvlleglgv
00448931   1/1  ellgled.ydvvliDtagrlrlpselsggqkqrvaiaralaaplppevllldep----------------
00509061   1/1  vdvvliDeaqflddlvelaevlad----------------------------------------------
00418341   1/1  lsaVllwldelsltalrrLq--------------------------------------------------
00475371   1/1  .lgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathd.ldavlkaadrilvldlggiv
00485931   1/1  legfdvvliDtagrgrrvgelsggqkqrvaiarallllldpelllldEptsglda..lrlllellkelgl
00469451   1/1  elvgledlldrlpgelSgGqrq.aiara.ard..pdllllDeptsalr.....gsenDp......etrae
00361211   1/1  enlalg......rarellerlglaildrlpgeLSgGqqqrvaiaralaldpdllllDeptsalssr....
00434401   1/1  ivdvydlsggerqr....aralasgpdvl-----------------------------------------
00468601   1/1  gydvvlidtaglld.ldrlvgelsggqkqrvaiaralaapevllldeptsgld-----------------
00484101   1/1  eler------------------------------------------------------------------
00367291   1/1  lflDEidalagkrg......sgtsrldpevqnaLlrlleelrvlsgvlviattnrpeel-----------
00437901   1/1  kpsvlllDEidal.................dpdvlnallklldglrdlsgvliilttnd-----------
00404191   1/1  llllDEidal...............gldpelqeellelldelaer.gvtlilttnnrpeeldqallrlls
00480251   1/1  ellllegydvvliDtagglqrglllalaladlllvllldepllvldatagtel-----------------
00513761   1/1  tldillealelleedydyiliDtpGglelrallalllaiaralaadeillvd------------------
00475381   1/1  ----------------------------------------------------------------------
00519421   1/1  idviliDEaqflddelveq---------------------------------------------------
00503741   1/1  yvnv------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00477561   1/1  .egg------------------------------------------------------------------
00406781   1/1  lllDEidalldarsgsgsggdsssrrvlnaLlrlleelr...llsgvtviat------------------
00509891   1/1  vaddlagal-------------------------------------------------------------
00478131   1/1  lkag------------------------------------------------------------------
00512891   1/1  tlikelsggekqrvalarallakpdvlllDEidgl..................dpdvleallelleelkr
00499191   1/1  relllelllalveglvvlldryprllsggqrqrv------------------------------------
00487061   1/1  ealleggkivlsarraqlleirlirpllaegkvvil----------------------------------
00422141   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GGRALKFFSSVRIDIRRIDSIKKDGEIVGNRVRAKVVKNKVAPPFRQAEFDLMYGEGISREGCIVDMAVE
00468951   1/1  vpdlagggvleqiadvviflerdeaykgilpaigglrelrvvKnrfgptgevalffii------------
00498531   1/1  gggvlehladvvlflerdeaykgirpaigvlrelrvvknrfgptgevglffiiteeGl------------
00510561   1/1  gggvlehiadvvlllerdeiylkdgldlvggrrelrvvKnrvgpvgsvalvfeiteeGl-----------
00498251   1/1  ggrilehgadtvlllrrdelyvagfeggglrrilrvvknrggptgeiaefei.teeGle-----------
00482551   1/1  qltrevedradkrpdlsdlrgggaleqladtvlller.........erggvreliivknrggp-------
00495031   1/1  kelgvtvilvthdlrevegrleladrvvvlrggrileqgadvvlflrrde.........gg---------
00439861   1/1  il......dalagggaleqladgvillkrdetak......ggrriliivknrggptgevplvfiitgegi
00488521   1/1  rellrlLkrlakelgvtvllvthdldevarladrvlvlaggrivehgadtvllleplg..----------
00495371   1/1  aeilrlLkrlakelgvtvllvthdleeveeladrvavlaggriveqgadvvlflrrde..----------
00500611   1/1  vthdlreveeladkrdrvvvlrggriveqgadvvlflrrde.........ggvrelivvknrl-------
00436481   1/1  ----------------------------------------------------------------------
00378181   1/1  ----------------------------------------------------------------------
00496111   1/1  vtvilvthdleeaedladsgriavladgrivlegdlae...............lglrralivlksrlgp-
00498541   1/1  ----------------------------------------------------------sklgelldlgve
00498261   1/1  ----------------------------------------------------------sklgelldlave
00468961   1/1  ----------------------------------------------------------sklgelldlgve
00510571   1/1  -----------------------------------------------------------llgelldlave
00490731   1/1  pgvvlNkl........------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00509061   1/1  ----------------------------------------------------------------------
00418341   1/1  ----------------------------------------------------------------------
00475371   1/1  lnkldlvakggaalel------------------------------------------------------
00485931   1/1  tvlvvthd..........dgtakggaalslaleladrilv------------------------------
00469451   1/1  ilrl------------------------------------------------------------------
00361211   1/1  .....ssendpetvaellellkelakelgvtvilvthdldlldsallrpgkr...pll------------
00434401   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00404191   1/1  rldrvivldl------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00519421   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00512891   1/1  sgvtvilttndldel.eladriall---------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AGVAKKSGAWYTYGEERLGQGREAAKQTLKENPDLREELETKVRESFEIPIITRSTEEADAMSPVAKPAK
00468951   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00439861   1/1  edlppfsa--------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00436481   1/1  ----------------------------------------------------------------------
00378181   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00498541   1/1  lgiveksGaWysyngeklgqGrenakeylkenpelaeeiekkvrellg----------------------
00498261   1/1  lgiveksGawysyngeklgqGrenakeylkenpelaeeiekkvrellg----------------------
00468961   1/1  lgiveksGaWysyngeklgqGrenakeylkenpelaeeiekkvrellg----------------------
00510571   1/1  lgiveksGawysyngeklgqGrenakeylkenpelaeeiekkvrellg----------------------
00490731   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00509061   1/1  ----------------------------------------------------------------------
00418341   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00519421   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KK--------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00495031   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00488521   1/1  ----------------------------------------------------------------------
00495371   1/1  ----------------------------------------------------------------------
00500611   1/1  ----------------------------------------------------------------------
00436481   1/1  ----------------------------------------------------------------------
00378181   1/1  ----------------------------------------------------------------------
00496111   1/1  ----------------------------------------------------------------------
00498541   1/1  ----------------------------------------------------------------------
00498261   1/1  ----------------------------------------------------------------------
00468961   1/1  ----------------------------------------------------------------------
00510571   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00509061   1/1  ----------------------------------------------------------------------
00418341   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00469451   1/1  ----------------------------------------------------------------------
00361211   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00519421   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00464411   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------