[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV55743.1


[Show Plain Result]

## Summary of Sequence Search
   1::394
   3::395 2.2e-156 57.7% 0044903 00449031 1/1   hoglycerate kinase                      
   4::395 1.2e-152 57.7% 0044642 00446421 1/1   hoglycerate kinase                      
   2::396 4.5e-152 57.3% 0042321 00423211 1/1   hoglycerate kinase                      
   3::396 4.6e-151 58.2% 0034787 00347871 1/1   hoglycerate kinase                      
   1::396 3.5e-150 56.5% 0040047 00400471 1/1   hoglycerate kinase                      
   3::396 3.5e-150 57.5% 0038550 00385501 1/1   hoglycerate kinase                      
   1::395 1.5e-148 56.7% 0040654 00406541 1/1   hoglycerate kinase                      
   1::395 1.5e-148 56.5% 0042919 00429191 1/1   hoglycerate kinase                      
  71::395 4.6e-120 55.6% 0037808 00378082 2/2   hoglycerate kinase                      
   1::69   2.3e-22 62.3% 0037808 00378081 1/2   hoglycerate kinase                      
   1::394


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAEIKTIDELDARGKRVLVRVDFNVPVKDGAVTDDTRIRAALPTIQKLVDDGARVILMSHLGRPAGEGFE
00449031   1/1  --nlltlddldlkgkrvlvrvDlnvPlddgkitddtriraalptikyllekgakvvllshlgrP.kgkvd
00446421   1/1  ---lltlddldlkgkrvlvrvDlnvPlddgkitddtriraalptikyllekgakvvllsHlgrPkg..le
00423211   1/1  -lnlltlddldlkgkrvlvrvDlnvPlddgkitddtriraalptikyllekgakvvllshlgrP.kgkvd
00347871   1/1  --nlltlddldlkgkrvlvrvDlnvPlkdgkitddtriraalptikyllekgakvvllshlgrPkglvle
00400471   1/1  lllnlltlddldlkgkrvlvrvDlnvPlddgkitddtriraalptikyllekgaksvvllshlgrPkgkv
00385501   1/1  --nlltlddldlkgkrvlvrvDlnvPlddgkitddtriraalptikylldkgaksvvllsHlgrPkgkvl
00406541   1/1  lellllnlltlddldlkgkrvlvrvDlnvPlddgkitddtriraalptikyllekgaksvvllshlgrP.
00429191   1/1  lllnlltlddldlkgkrvlvrvDlnvPlddgkitddtriraalptikyllekgaksvvllshlGrP.kge
00378082   2/2  ----------------------------------------------------------------------
00378081   1/2  llnlltlddldlkgkrvlvrvdlnvPlddgkitddtriraalptiklllekgaklvvllshlGrPkgkl-


                         -         -         *         -         -         -         -:140
query           ESFTLRPAAQKLSELMGKPVVFATDTVGDDARAKAASLRDGDVLVVENLRFDKREKKNDPAFCEELAALG
00449031   1/1  dklslkpvaellsellgkevlfvddlvgeeveeavaslkdgevllleNvrflkeeekndeelakklasla
00446421   1/1  dklslkpvaellsellgkevlfvddlvgeeveeavadlkdgevllleNvrflkeeekndeelakklasla
00423211   1/1  dklslkpvaellsellgkevlfvddlvgeeveeavadlkdgevllleNvrflkeeekndeelakklasla
00347871   1/1  lseeeeleelelllddklslkpvaellsellgkevlfvddlvg..aleavaslkdgevllLeNlrfykee
00400471   1/1  lddklslkpvaellsellgkevlfvddlvgeeveeavadlkdgevllLenlrflkeeekndldeegekvk
00385501   1/1  edklslkpvaellsellgkevlfvddlvgeeveeavadlkdgevllleNvrflkeeekndldeegekvka
00406541   1/1  kgklddklslkpvaellsellgkevlfvddlvgeeveeavaslkdgevllLeNvrflkeeekndldeege
00429191   1/1  lddklslkpvaellsellgkevlfvddlvgeeveeavadlkdgevllLeNlrflkeeelkgleegekvka
00378082   2/2  dklslkpvaellsellgkevlfvddlvgeeveeavadlkdGevllLeNvrfykeeelkgleegekvkaes
00378081   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EAYVNDAFGTAHRAHASTAGVAALLPAYAGYLMQREVATLSGMLEEPRRPFTAILGGSKVSDKIKVIDAL
00449031   1/1  dvyvndaFgtahrahastvgvakllpsaaGlllekElealskalenperPlvailGGakvsdklkvlenl
00446421   1/1  dvyvndaFgtahrahaslvgvakllpsaaGlllekElealskalenperPlvailGGakvsdklgvlenl
00423211   1/1  dvyvndaFgtahrahaslvgvakllpsaaGlllekElealskalenperPlvailGGakvsdklgvlenl
00347871   1/1  elkeskndeelakklasladvyvndAFgtahrahastvgvakllplsaaGlllekElealskalenperP
00400471   1/1  aeseeeeelakklasladvyvndAFgtahrahaslvgvall.psaaGlllekElealskalenperPlva
00385501   1/1  eseeeeelakklasladvyvndaFgtahrahaslvgvall.psaaGlllekelealskalenperPlvai
00406541   1/1  kvkaeseeeeelakklasladvyvndAFgtahrahaslvgvall.psaaGlllekElealskalenperP
00429191   1/1  eskndeelakklasladvyvndAFgtahrahaslvgvall.psaaGlllekElealskalenperPlvai
00378082   2/2  kndeelakklasladvyvndAFgtahrahaslvgvall.psaaGlllekElealskalenperPlvailG
00378081   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           MDKCDTLIIGGGMCFTFLLAQGKAVGTSLKEEDWVERAAAMIAKAEERGVQLLLPVDVVCADRFAEDAET
00449031   1/1  ldkvdklligGglantflkalglevgkslveedlldlakellelaeekgvkillPvdvvvadefsadael
00446421   1/1  ldkvdklligGglantflkalglevgkslveedlldlakellelaeekgvkillPvdvvvadefsedael
00423211   1/1  ldkvdklligGglantflkalglevgkslveedlldlakellelaeekgvkillPvdvvvadefsedael
00347871   1/1  lvailGGakvsdklgvlenlldkvdklligGglantflkalglevgkslveedlldlakellelaeekgv
00400471   1/1  ilGGakvsdklkvlenlldkvdklligGglantflkalkgleigkslveedlldlakellelaeekgvki
00385501   1/1  lGGakvsdklkvlenlldkvdklligGglaftflkalkgleigkslveedlldlvkellelaeekgvkil
00406541   1/1  lvailGGakvsdklkvlenlldkvdklligGglantflkalkgleigkslveedlldlakellelaeekg
00429191   1/1  lGGakvsdklkvlenlldkvdklligGglantflkalkgleigkslveedlldlakellelaeekgvkil
00378082   2/2  GakvsdklkvlenlldkvdklligGglantflkallgleigkslveedlldlakellelaeekgvkillP
00378081   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LTVSVDGIPGDMMGLDIGPETAKLYADAVAQAKTVFWNGPMGVFEMKAFEAGTKAVAEAVAANADADTII
00449031   1/1  llvvlvdeipddlmilDiGpetielfaellkkaktvlwnGPlGvfelenfakGtlalaealaeltksgal
00446421   1/1  lvvdvdeipddlmilDiGpktielfaellkkaktvlwnGPlGvfelenfakGtlalaealaelsgalsiv
00423211   1/1  lvvdvdeipddlmilDiGpetielfaellkkaktvlwnGPlGvfelenfakGtlalaealaelsgalsiv
00347871   1/1  killPvdvvvadefsadaellvvdvdeipddlmilDiGpktielfaelikkaktvvwnGPlGvfelenFa
00400471   1/1  llPvdvvvadefsadaelllvvlvdeipddlmilDiGpktielfaelikeaktvvwnGPlGvfelenFak
00385501   1/1  lPvdvvvadefsedaellevvlvdeipddlmilDiGpktielfaelikkaktvvwnGPlGvfelenfakG
00406541   1/1  vkillPvdvvvadefsedaelllvvlvdeipddlmilDiGpetielfaelikeaktvvwnGPlGvfelen
00429191   1/1  lPvdvvvadefsadaelllvvlvdeipddlmilDiGpktielfaelikkaktvvwnGPlGvfelenFakG
00378082   2/2  vdvvvadefsadaelllvvlvdeipddlmilDiGpktielfaeliaeaktvvwnGPlGvfelenfakGtl
00378081   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GGGDSVAAVNKFDLAEQMTFISTGGGASMELVQGEALPGVEALK--------------------------
00449031   1/1  sivGGGdtaaaveklgladklshvstGGGAslellegkeLPgvea-------------------------
00446421   1/1  gGgdtaaaveklgladklshvstGGGAslellegkeLPgveaLee-------------------------
00423211   1/1  gGgdtaaaveklgladklshvstGGGAslellegkeLPgveaLeek------------------------
00347871   1/1  kGtlalaealaeltkesgalsivGGgdtaaaveklgladklshvst------------------------
00400471   1/1  GtlalaeaiaeltksgalsivGGGdtaaaveklgladklshvstGG------------------------
00385501   1/1  tlalaeavaeltksgalsivGGGdtaaaveklgladklshvstGGG------------------------
00406541   1/1  FakGtlalakalaeltksgalsivGGGdtaaaveklgladklshv-------------------------
00429191   1/1  tlalaealaeltksgalsivGGGdtaaaveklgladklshvstGG-------------------------
00378082   2/2  alakavaeltesgalsivGGGdtaaaveklgladkfshvstGGgA-------------------------
00378081   1/2  ----------------------------------------------------------------------