[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV55893.1


[Show Plain Result]

## Summary of Sequence Search
   1::501
   7::137  5.7e-32 30.2% 0043831 00438311 1/1   er factor ribosome-binding domain       
   7::139  3.3e-29 29.8% 0050345 00503451 1/1   er factor ribosome-binding domain       
 263::453  3.5e-25 27.0% 0050344 00503441 1/1   r factor/SurA peptide-binding domain-li 
 263::400  6.3e-21 25.0% 0043830 00438301 1/1   r factor/SurA peptide-binding domain-li 
  94::258  5.9e-13 21.4% 0037500 00375001 1/1   like                                    
 140::262  5.1e-12 32.1% 0044934 00449341 1/1   like                                    
 143::262  1.7e-11 30.3% 0043832 00438321 1/1   like                                    
 152::264  6.1e-10 27.5% 0040355 00403551 1/1   like                                    
 167::256  3.6e-07 33.3% 0038779 00387791 1/1   like                                    
 167::257    3e-06 23.1% 0039255 00392551 1/1   like                                    
 121::275  5.8e-06 22.2% 0039784 00397841 1/1   like                                    
 132::258  9.5e-05 21.3% 0041183 00411831 1/1   like                                    
 167::256  0.00038 24.4% 0035884 00358841 1/1   like                                    
 167::256  0.00043 24.4% 0035600 00356001 1/1   like                                    
 256::361  0.00067 24.5% 0048096 00480961 1/2   r factor/SurA peptide-binding domain-li 
 167::256  0.00079 24.4% 0045075 00450751 1/1   like                                    
 362::485    0.018 22.0% 0048096 00480962 2/2   r factor/SurA peptide-binding domain-li 
   1::501


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MMEDSYVETKVEALEDNRTKVTVTVDAADIDARIKKTYKDFANKYNFPGFRKGKAPRPIIDNALGAEAVR
00438311   1/1  ------mkvtvekleglkvelevevpaeeleealdkalkelaknvkipGFRkGkvPlslvekrygke.ll
00503451   1/1  ------mkvtvekleglkvklevevpaeeleeavdkalkelakkvkipGFRkGkvPlsllekrygke.vl
00503441   1/1  ----------------------------------------------------------------------
00438301   1/1  ----------------------------------------------------------------------
00375001   1/1  ----------------------------------------------------------------------
00449341   1/1  ----------------------------------------------------------------------
00438321   1/1  ----------------------------------------------------------------------
00403551   1/1  ----------------------------------------------------------------------
00387791   1/1  ----------------------------------------------------------------------
00392551   1/1  ----------------------------------------------------------------------
00397841   1/1  ----------------------------------------------------------------------
00411831   1/1  ----------------------------------------------------------------------
00358841   1/1  ----------------------------------------------------------------------
00356001   1/1  ----------------------------------------------------------------------
00480961   1/2  ----------------------------------------------------------------------
00450751   1/1  ----------------------------------------------------------------------
00480962   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ATVTDDVVNGTYPLAIDDCDLYPIAKPEFDETDLVEAGKPYTFSFTVTVKPEIEISSYEPVEIELPAEGT
00438311   1/1  aevlnelldeafsealeeekirplgqpeieive.ledgkdleftasvevlPevelgdykglevekpv---
00503451   1/1  eealnelldealeealeeekleplgqpeievve.leegedleftaevevlPevelgdykglevekleve-
00503441   1/1  ----------------------------------------------------------------------
00438301   1/1  ----------------------------------------------------------------------
00375001   1/1  -----------------------vdqpklsyalglslgdll.lkagfevlpevllkglkdalvgkpvvlv
00449341   1/1  ---------------------------------------------------------------------v
00438321   1/1  ----------------------------------------------------------------------
00403551   1/1  ----------------------------------------------------------------------
00387791   1/1  ----------------------------------------------------------------------
00392551   1/1  ----------------------------------------------------------------------
00397841   1/1  --------------------------------------------------pllelgelgllnlilgeafl
00411831   1/1  -------------------------------------------------------------lleklavev
00358841   1/1  ----------------------------------------------------------------------
00356001   1/1  ----------------------------------------------------------------------
00480961   1/2  ----------------------------------------------------------------------
00450751   1/1  ----------------------------------------------------------------------
00480962   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TDAEIDEQIDALREHYYSFEDASAATKVKEDSYIDLAMKATDDKGEEIPSLTTENRPYGLGANLFPAEFD
00438311   1/1  ----------------------------------------------------------------------
00503451   1/1  ----------------------------------------------------------------------
00503441   1/1  ----------------------------------------------------------------------
00438301   1/1  ----------------------------------------------------------------------
00375001   1/1  deelvdelleelrklaaalvlalgevgeenliegeaflaenakkegvvtldsgllykvlkegdgekpkkg
00449341   1/1  tdedvdeeleslleklallegvg..raakkgdtVtvdytgtl.dgevfdssydrpfsfvlgsgqvipgfe
00438321   1/1  --edvdktleslleklallegvg..raakkgdtVtvdytgtl.dgevfdssydrpfsfvlglgqvipgfe
00403551   1/1  -----------gllylvllegegr..aakkgdvVtvdytgtl.dgevfdssydrpfsfvlgsgqvipgle
00387791   1/1  --------------------------aakkgdlvtvdyvgtl.dgevfdssldrpfsftlgsgqvipgfe
00392551   1/1  --------------------------kvkkgdvVtvhytgtlldgtvfdssyerlakeagilleggegep
00397841   1/1  avlvtladvitldsgllkkvlkege..garkpkkgdtVtvhytgklldGtvfdssydrplpftlglgqvi
00411831   1/1  lvilldsgllklilkegt.....gdrkpkkgdtVtvhytgtlldgtvfdssygrgeplefvlgsgqvipg
00358841   1/1  --------------------------gllkkvlkegegdlkpkkgdtVtvhytgklldgtvfdssydrge
00356001   1/1  --------------------------GllkkvlvegegalkpkkgdtVtvhytgtlldgtvfdssydrge
00480961   1/2  ----------------------------------------------------------------------
00450751   1/1  --------------------------vllldsgllkkvlvegegdrkpkkgdlVtvhytgtlldgtvfds
00480962   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EQLVGLKKGQTATFTLDMPADPPIMLSALAGKTEKINFEVEVKVVKKKIVPEVNDEWAKEQMGFESVEDL
00438311   1/1  ----------------------------------------------------------------------
00503451   1/1  ----------------------------------------------------------------------
00503441   1/1  ----------------------------------------------------LDdefakklgvefetlee
00438301   1/1  ----------------------------------------------------lddefakklgvefetlee
00375001   1/1  dtVtvhYtgtlldGtvFdssygrpfpftlglgqvipGfeegLlgmkvG----------------------
00449341   1/1  egllgmkvGekrtltippplaYgneg......lagkt..lvFevellevkea------------------
00438321   1/1  egllgmkvGekrtltippplaYgneg......lagkt..lvFevellevkea------------------
00403551   1/1  egllgmkvGekrtltippelaYgneg......lagkt..lvFevellevkeael----------------
00387791   1/1  egllgmkvGekrtltippplaYgeeg......lagkt..lvFevel------------------------
00392551   1/1  ltfvlGsgqvipgleeallgmkvGekrtltippelaYgergpglvil-----------------------
00397841   1/1  pGleegllgmkvGekrlltippelaYgerglgglippgatlvFeveLldvkkakepelldglakl-----
00411831   1/1  leegllgmkvGekrlltippelaYgerglpglippgatlvFeveLldv----------------------
00358841   1/1  plefvlgsgqvipgleegllgmkvGekrtltippelaYgerglggl------------------------
00356001   1/1  plefvlgsgqvipgleeallgmkvGekalltippelaYgerglglv------------------------
00480961   1/2  ---------------------------------------------ldkvvavVngevIteseldqrlkll
00450751   1/1  sygrgeplefvlgsgqvipgleegllgmkvGekrlltippelaYge------------------------
00480962   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RARIAESVTSQKADMMPRLKENACLYALAERVEGDVPEAMLEDAEASLIQDFFQQLQSQGMTFDVYLAQQ
00438311   1/1  ----------------------------------------------------------------------
00503451   1/1  ----------------------------------------------------------------------
00503441   1/1  lkekikeqleeeleqaakaelkeavldaLvenaefdlPeslveeeidrlleqllqqlqqqgldleel...
00438301   1/1  lkedirknleeeleeklkaelkeelldkLlelneielPeslveeeidrlleqllqqlgqqgldleel...
00375001   1/1  ----------------------------------------------------------------------
00449341   1/1  ----------------------------------------------------------------------
00438321   1/1  ----------------------------------------------------------------------
00403551   1/1  ----------------------------------------------------------------------
00387791   1/1  ----------------------------------------------------------------------
00392551   1/1  ----------------------------------------------------------------------
00397841   1/1  ----------------------------------------------------------------------
00411831   1/1  ----------------------------------------------------------------------
00358841   1/1  ----------------------------------------------------------------------
00356001   1/1  ----------------------------------------------------------------------
00480961   1/2  laqlqqqggdlpdeeelrkqalerlideklllqeakklgievsdeevdqai....eefakqyglsleqfk
00450751   1/1  ----------------------------------------------------------------------
00480962   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GITPDQFKEDVKKQAEDMSKQDLALDAWARHFGMEATAEEVTEEFVKSGVEDPAALEAEWRSNGQLHMVR
00438311   1/1  ----------------------------------------------------------------------
00503451   1/1  ----------------------------------------------------------------------
00503441   1/1  .......lreelreeAekrvklglileeiakkenievsdeeleaeieelaeqygmplevvkeylsnqell
00438301   1/1  .......lreelreeaekrvklgLlleeiakkekievseeelealieela--------------------
00375001   1/1  ----------------------------------------------------------------------
00449341   1/1  ----------------------------------------------------------------------
00438321   1/1  ----------------------------------------------------------------------
00403551   1/1  ----------------------------------------------------------------------
00387791   1/1  ----------------------------------------------------------------------
00392551   1/1  ----------------------------------------------------------------------
00397841   1/1  ----------------------------------------------------------------------
00411831   1/1  ----------------------------------------------------------------------
00358841   1/1  ----------------------------------------------------------------------
00356001   1/1  ----------------------------------------------------------------------
00480961   1/2  aaLaqngltpe-----------------------------------------------------------
00450751   1/1  ----------------------------------------------------------------------
00480962   2/2  -----------rkqalerlideklllqeakklgievsdeevdqaieefakqyglsleqfkaaLaqngltp


                         -         -         +         -         -         -         -:490
query           QGVIRTKAVKDIMDKAVVTELDLSKKKDEEKKPAKKAAAKKTAKKDEAAGDEPAKKPAKKAAPKKAAKKD
00438311   1/1  ----------------------------------------------------------------------
00503451   1/1  ----------------------------------------------------------------------
00503441   1/1  ealradlleekvvdlllekakvtekevsfeell-------------------------------------
00438301   1/1  ----------------------------------------------------------------------
00375001   1/1  ----------------------------------------------------------------------
00449341   1/1  ----------------------------------------------------------------------
00438321   1/1  ----------------------------------------------------------------------
00403551   1/1  ----------------------------------------------------------------------
00387791   1/1  ----------------------------------------------------------------------
00392551   1/1  ----------------------------------------------------------------------
00397841   1/1  ----------------------------------------------------------------------
00411831   1/1  ----------------------------------------------------------------------
00358841   1/1  ----------------------------------------------------------------------
00356001   1/1  ----------------------------------------------------------------------
00480961   1/2  ----------------------------------------------------------------------
00450751   1/1  ----------------------------------------------------------------------
00480962   2/2  eefreqlreelllqklldalvaskvkvtdeevkayyeenk.peevrlshilvkveeeakealael-----


                         *         -         -         -         -         +         -:560
query           EDVEAKADDAE-----------------------------------------------------------
00438311   1/1  ----------------------------------------------------------------------
00503451   1/1  ----------------------------------------------------------------------
00503441   1/1  ----------------------------------------------------------------------
00438301   1/1  ----------------------------------------------------------------------
00375001   1/1  ----------------------------------------------------------------------
00449341   1/1  ----------------------------------------------------------------------
00438321   1/1  ----------------------------------------------------------------------
00403551   1/1  ----------------------------------------------------------------------
00387791   1/1  ----------------------------------------------------------------------
00392551   1/1  ----------------------------------------------------------------------
00397841   1/1  ----------------------------------------------------------------------
00411831   1/1  ----------------------------------------------------------------------
00358841   1/1  ----------------------------------------------------------------------
00356001   1/1  ----------------------------------------------------------------------
00480961   1/2  ----------------------------------------------------------------------
00450751   1/1  ----------------------------------------------------------------------
00480962   2/2  ----------------------------------------------------------------------