[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV55965.1


[Show Plain Result]

## Summary of Sequence Search
   1::85
  38::80   0.00017 34.9% 0052220 00522201 1/1   n-helix-helix                           
   1::85


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSNEKITSENLEELFDEGCDVTGFFDFDSAVVVEGRTETKRVNVDMPIWMVEALDKEAKRVGIGRQAVIK
00522201   1/1  -------------------------------------ekkrvgvslpeellekleelakelglskSglva


                         -         -         *         -         -         -         -:140
query           MWLAERLDEEARRSA-------------------------------------------------------
00522201   1/1  laleeyleke------------------------------------------------------------