[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV56026.1


[Show Plain Result]

## Summary of Sequence Search
   1::278
   3::278  9.5e-46 35.6% 0044661 00446611 1/1   inase-like                              
   1::277  1.3e-43 31.7% 0046577 00465771 1/1   inase-like                              
  14::268  2.1e-35 31.8% 0051846 00518461 1/1   inase-like                              
   9::268  2.3e-26 30.6% 0047908 00479081 1/1   inase-like                              
  17::253  7.5e-15 25.5% 0049846 00498461 1/1   inase-like                              
  73::259  2.2e-07 28.7% 0047705 00477051 1/1   inase-like                              
   1::278


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEPFALKRALDNVRATTPLVHNITNYVTVNDCANALLAIGASPIMSDEPADVFDITSICGGLTLNIGTLN
00446611   1/1  --Gagiladlkalrlgaglvtvitnlvaqntiavyllalgalplmaevleeleellkdadalvigigllg
00465771   1/1  idsgggagigadllaalalgrygtglvtvltaqntllvlgasplmaddleellelledadvlvigpGlll
00518461   1/1  -------------gaaaplitalpelvvlgvlan......aspimadlleellelleradalvigpGllr
00479081   1/1  --------alaalragaglvtvatpdntanvlasllpelmvlple.dlleqleelleradalvigpglgr
00498461   1/1  ----------------mgrvlviggsdsgGgaginaalkalaalgvdvtlvitaltaqntilvlpgaals
00477051   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ERSIQGMFAAGERASELGHPIVLDPVGAGASALRTRTASDLLDKLAVSVVRGNMSEAKALAGGAAATRGV
00446611   1/1  slaaeavlaaaelareagkpvvlDpvglgalgfrleallelllp.ladvltPNlgEaaaLlglevalkgv
00465771   1/1  sesleailaalelakeagipvvlDpvglgalllreelleallelllpdiitPNegEaerltglkllllkg
00518461   1/1  ..seeaielvaellkeagvpvvlDadalnalalllelllp.....katvltPNlgElarLlg........
00479081   1/1  d...eavlalleaaleagkpvvlDadalnllaerl........lplatvltPnlgEaarLl.........
00498461   1/1  peelaellealleladadavligllgsaeaieavaellkaak.gvpvvlDPvmadasglrllaeealaal
00477051   1/1  --saeiieavaellkklpgvpvvlDPvmadasglllladealealleellpladlitPNltEaalLlglp


                         +         -         -         -         -         *         -:210
query           DVCPGDAVTEDNLAAGAAFARDFAAKTGAVVAVTGAIDIVADAERAYAVRNGSPLMGRITGAGCMLSCVC
00446611   1/1  dsl......eesledlleaaralaelgaavvvvtGahdviadggevlvvpagkvllvdttGaGDtlaaai
00465771   1/1  vd.......sildledlleaakalaklggkvvvltGakgllvdggevlvvpagkvevvdttGaGDtlaga
00518461   1/1  .......lsiddvedrleaarelaekggavvvlkGahdliadgdgvlvnatgnpal.atgGtGDvlagii
00479081   1/1  .....glsvddvledrleaaralaalggavvllkGahdliatdggrvyvnatgnpal.atgGaGDvLaGa
00498461   1/1  leellpladvitPNltEaelltgl...............pitsledlleaarallalgakaVvvtggalg
00477051   1/1  vie..............teedllaaarallelgakaVlvtgghlegdlvgdllvdgdgvlllpaprvevv


                         -         -         -         +         -         -         -:280
query           AAFATANPDALLDATVAAVVGMGLAGQIAQGRMGGYDGNGSFRTYLLDALYNLDGDALEAGARVEELA--
00446611   1/1  aaflaqg..dlleaarlAvaaaglavelagaq...gsgpgllahdlldelpllleelleellkillve--
00465771   1/1  laaglaqgls.leeaarlAvaaaalaielagal.glglgpgllasdlldalplllkelllellkiel---
00518461   1/1  aallaqgl.dlleaaalAvalhglaaelaael.....gpgllasdlldaLplllkell------------
00479081   1/1  iaallaqgld.lleaaalAvylhgaaadlave...klgtggllasdlidalpkvlkel------------
00498461   1/1  gdllvalladgggvvrvpaprvevvdttGaGDtfaaalaaala---------------------------
00477051   1/1  dttGaGDtlsaalaaalaqg.lsleeavrlAvaavalaver.gaqlgig---------------------