[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV56092.1


[Show Plain Result]

## Summary of Sequence Search
   1::166
   2::85   9.4e-29 45.1% 0050580 00505801 1/1   omal L11/L12e N-terminal domain         
  68::141  2.6e-25 56.8% 0047166 00471661 1/1   omal protein L11, C-terminal domain     
  72::141  2.3e-23 55.7% 0049332 00493321 1/1   omal protein L11, C-terminal domain     
  72::141  4.2e-23 55.7% 0048192 00481921 1/1   omal protein L11, C-terminal domain     
   9::71   1.1e-22 63.5% 0041008 00410081 1/1   omal L11/L12e N-terminal domain         
   1::166


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAEKKQTGFIKLQIPAGAANPAPPVGPALGAQGVNIMQFCQAFNAQTQDQSGTIIPVEITVYEDKSFTFV
00505801   1/1  -geeleemppkldkkvvkvvklrvvgGeagpapplgPalgplglnikkvvkeinkaTkdlkGlrvpvkit
00471661   1/1  -------------------------------------------------------------------tfi
00493321   1/1  ----------------------------------------------------------------------
00481921   1/1  ----------------------------------------------------------------------
00410081   1/1  --------likllipagkanpapplgpaLGqlginimefvkefnektkdllglpvpvlitvyedksfefi


                         -         -         *         -         -         -         -:140
query           CKTPPAAVLIKEKLNINSGSGLPHVQPVGTLTEDQLREIAEIKMPDLNANTIEAAMEIIAGTARSMGVRI
00505801   1/1  vqndkafvfvv..Pp-------------------------------------------------------
00471661   1/1  lktPpasvllkkaagiekgsgkpnkekvgkltleqvleiAklklpdlnaldleaavkiilGtarsmGiev
00493321   1/1  -ktPpasvllkkaagiekgsgkpnkekvgkltleqvleiAklklpdllaldleaavkiilGtarsmGiev
00481921   1/1  -ktPpasvllkkaagiekgsgkpnkekvgkltleqvleiAklklpdllaldleaavkiilGtarsmGiev
00410081   1/1  l---------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EGREMKIKYVPSKKVAAMLQGKTLED--------------------------------------------
00505801   1/1  ----------------------------------------------------------------------
00471661   1/1  e---------------------------------------------------------------------
00493321   1/1  e---------------------------------------------------------------------
00481921   1/1  e---------------------------------------------------------------------
00410081   1/1  ----------------------------------------------------------------------