[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV56185.1


[Show Plain Result]

## Summary of Sequence Search
   1::280
 106::279    3e-40 38.7% 0048485 00484851 1/1   inate/Quinolinate PRTase C-terminal dom 
 106::277  1.8e-39 38.3% 0049008 00490081 1/1   inate/Quinolinate PRTase C-terminal dom 
 106::278  1.5e-35 35.2% 0048915 00489151 1/1   inate/Quinolinate PRTase C-terminal dom 
   1::105  8.7e-23 33.3% 0042921 00429211 1/1   inate/Quinolinate PRTase N-terminal dom 
   4::105  8.4e-22 33.3% 0042684 00426841 1/1   inate/Quinolinate PRTase N-terminal dom 
   2::105  4.6e-19 30.4% 0048486 00484861 1/1   inate/Quinolinate PRTase N-terminal dom 
  92::261    4e-06 24.3% 0051442 00514421 1/1   ose-phoshate binding barrel             
 153::266  6.1e-06 23.4% 0049848 00498481 1/1   ase                                     
 196::270  2.3e-05 30.0% 0045046 00450461 1/1   in phosphate synthase                   
 198::268  0.00018 33.3% 0047140 00471401 1/1   inked oxidoreductases                   
 196::267  0.00021 22.5% 0050246 00502461 1/1   ase                                     
 199::270  0.00022 22.2% 0049721 00497211 1/1   like                                    
 110::268  0.00025 28.4% 0047026 00470261 1/1   inked oxidoreductases                   
 196::261  0.00029 31.2% 0047889 00478891 1/1   ose-phoshate binding barrel             
 196::281   0.0004 25.9% 0051164 00511641 1/1   ose-phoshate binding barrel             
   1::280


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLRISDTRIDGFIAEDVPYVDLTCAVLGIGDEPGEMEYFTREDCVLAGANVVARIMGKLGCDVVEARRDG
00484851   1/1  ----------------------------------------------------------------------
00490081   1/1  ----------------------------------------------------------------------
00489151   1/1  ----------------------------------------------------------------------
00429211   1/1  llldlllllleelleaalaeDlgragDlttlaliledllatavliaredgvlaGlevaaevfelldpadg
00426841   1/1  ---ellllllldllkllleelvrlalaeDlgyldlagdlttlalipedllatavliaredgvlaGlevae
00484861   1/1  -lllleellelaLaeDlgsgDlttllli..dllatavliakedgvllaGldvaeevfelldlevellvkd
00514421   1/1  ----------------------------------------------------------------------
00498481   1/1  ----------------------------------------------------------------------
00450461   1/1  ----------------------------------------------------------------------
00471401   1/1  ----------------------------------------------------------------------
00502461   1/1  ----------------------------------------------------------------------
00497211   1/1  ----------------------------------------------------------------------
00470261   1/1  ----------------------------------------------------------------------
00478891   1/1  ----------------------------------------------------------------------
00511641   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ERATAGEAFFRVRGTAGDLHAAWKVCLNVFDHMSAVATKTRAMVDAAHAENPRCEVLTTRKSMPGAKDLL
00484851   1/1  -----------------------------------iAtltarlvdaak....gtklldtRktlPglrlle
00490081   1/1  -----------------------------------iAtltarlvdaak..gtgvlildtRktlPglrlle
00489151   1/1  -----------------------------------iatatrklvdall..dvhlmildtrktlPglrlle
00429211   1/1  levellvkdGdlveagevlltveGparslltaeRv-----------------------------------
00426841   1/1  evfellldpglevewlvkdGdlveagevlleveGp-----------------------------------
00484861   1/1  GdlvkagdvlleveGparslltaeRvaLnllqrls-----------------------------------
00514421   1/1  ---------------------lmeiipaidlldgklvaevkgplpvllvgpdpedlaelaeaaeeaGada
00498481   1/1  ----------------------------------------------------------------------
00450461   1/1  ----------------------------------------------------------------------
00471401   1/1  ----------------------------------------------------------------------
00502461   1/1  ----------------------------------------------------------------------
00497211   1/1  ----------------------------------------------------------------------
00470261   1/1  ---------------------------------------laellrraeaagadaivltvglpvlgvrerd
00478891   1/1  ----------------------------------------------------------------------
00511641   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TEAVMAGGAFPHRLGLSETVLVFDHHLTFFGGFEAFVEQLPDIKGRCVEKKLFVEADAERARVLARAGVD
00484851   1/1  kyAvliGGglnhrlglsdavlikdnhiaalggieeaveaarellp..levkievevdtleealealeaga
00490081   1/1  kyAvlvGGglnhrlglsdavlikdnhiaalggieeaveaarelape...lkievevesleealealeaga
00489151   1/1  kyAvlvgGalnhRlglsdavlikdnhiaaaggiaeavkla...relgpeakievevetleelleallaga
00429211   1/1  ----------------------------------------------------------------------
00426841   1/1  ----------------------------------------------------------------------
00484861   1/1  ----------------------------------------------------------------------
00514421   1/1  ievndldpikairkavdvpvivkdfiglplavggglrdpeeaeaaleaGadgvvlgaaagyllglellae
00498481   1/1  ------------eaGadeidlvincgalkagdpelvlelikavreavggvpvkviletglltveeiveaa
00450461   1/1  -------------------------------------------------------htleealeaeelgad
00471401   1/1  ---------------------------------------------------------velaraaeeaGad
00502461   1/1  -------------------------------------------------------atptealaalelgad
00497211   1/1  ----------------------------------------------------------ealedlielGvv
00470261   1/1  lrlgfllppaaggalladlaralalvlagadelvlvvsdg..dpeglleliealreatgvpvivkgva..
00478891   1/1  -------------------------------------------------------tsleeakaalelgad
00511641   1/1  -------------------------------------------------------atveeAkraeeaGad


                         -         -         -         +         -         -         -:280
query           GIQVDKVPVDELEPLVRELRAIDPHVTLIAAGGVNPQNAGAYAATGVDGLATTAPFSAKPLDMSVRMRPL
00484851   1/1  divlldnfspeelreavrllkdlagrvlleasGgitleniaelaetgvdvisvgalthsapalDlsldi-
00490081   1/1  divllDnfspeelreavellkglaprvlleasGgitlenvaelaetgvdvisvgalthsakalDlsl---
00489151   1/1  diilldnvnpeflreavklig...grilleasGgitleniaelaeaGvdvivvgsltfsapdldlslk--
00429211   1/1  ----------------------------------------------------------------------
00426841   1/1  ----------------------------------------------------------------------
00484861   1/1  ----------------------------------------------------------------------
00514421   1/1  lvkaakelgpglivlvgvl................tleeakaaeeaGadai-------------------
00498481   1/1  raaveaGadfiktstgggsggatlevlaliveavgg...kipviaaGGirtaedal--------------
00450461   1/1  yillgpvfptgtkpgfgplglellrelveav.....kipviasGGitpenaaealeaGad----------
00471401   1/1  giivhnrtgtqlidvearkallglglgsinetgglsgpaippaa..leliaevreavp------------
00502461   1/1  yvklfpaep.ggpeylkalrgplpdipivatGGisldnaaeylaaGavavavgsalf-------------
00497211   1/1  riltsGgaagaleglellkelvelagripivagGGitlenikelleagadgvhvgsallr----------
00470261   1/1  tvedaraaaeaGadaivvsggggggldvgvptlealpevaeavggdipviadGGIrtg------------
00478891   1/1  yvlvglvvgtggdgvvfgpaglellrelre..ldipvivdGGitpedaaea-------------------
00511641   1/1  aigvgvhggtdvtkdgglggpdlellkevveav.dipviaeGgIntpedakkalalGadavmvGsailgn