[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV56217.1


[Show Plain Result]

## Summary of Sequence Search
   1::295
   2::273  3.1e-27 24.1% 0048659 00486591 1/1   lysophospholipase-like                  
   3::172  3.6e-06 29.0% 0036023 00360231 1/1   lysophospholipase-like                  
   1::295


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MMTSTVHDVALVFEGGGMRNSYSAGAIGVMLEQGLFFDDVYGLSAGATNAIDYVSRDARRNEASFTACLD
00486591   1/1  -lsgpk..iaLvLsGGGarGayhaGvlkaLeealpeltgdgglppldyfdliaGtSaGaliaallaagqp
00360231   1/1  --llvRlasglsdeEkeflekRrkvvaealkkllkrlnlaedlsadevpviaLalsGGGaRamlahaGvl


                         -         -         *         -         -         -         -:140
query           DLSFRWWVMPFVDADGVGAALHGDARVRSSCALPFDFDAFQANPARVTLQAIDRDTGETVCFTRGDFPTE
00486591   1/1  agrprlsldeleelyleladkifdls........lllsgglydgdplrellrellgdltfedlprplfvv
00360231   1/1  kaLderglldcvdyiaGvSgGswvaallasgnfwsikdledlilelkdsllkspllllslellksllkel


                         +         -         -         -         -         *         -:210
query           QTLMERVRASTSYPIVLPPTVVDGRALYDGGIGRGGGIMVPRAMDDGLSRFFVVCTRPRGFRRPLKPNRF
00486591   1/1  atdlstgkpvvfsngdskeetapnvlladavrASsaiPglfppveilakdpldgrleglyvDGGvlddnl
00360231   1/1  lekkdagfdvsltDlwGlllsyllvd.ggldl--------------------------------------


                         -         -         -         +         -         -         -:280
query           YDAFFWRRPRMREALDTWNRRYDAELDRLDRLEAEGRAYVFYANDQGVKNTERDAEKLARNYERGRMQAL
00486591   1/1  Pllpalaradriiavdvsldsqvnpdigpllvlslgtglslilnrlnlp.elllnlglldlll-------
00360231   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           SEFDRWERFLSGQGV-------------------------------------------------------
00486591   1/1  ----------------------------------------------------------------------
00360231   1/1  ----------------------------------------------------------------------