[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV56230.1


[Show Plain Result]

## Summary of Sequence Search
   1::264
   6::234  8.6e-43 30.9% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
  10::234  1.5e-42 29.5% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
  10::236  6.6e-42 30.7% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
   9::234  1.4e-41 31.2% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
  10::234  6.2e-41 30.9% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
   9::234  1.1e-40 30.7% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
  12::233  1.1e-40 27.0% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
   8::234  1.3e-40 29.0% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
  10::234  1.6e-40 30.4% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
   7::234    2e-40 29.1% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
   4::234  1.2e-39 30.6% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
  10::234    2e-39 30.8% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
   4::234  4.1e-39 30.9% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
   1::239    5e-39 31.3% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
   9::234  1.2e-38 30.7% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
   5::234  1.7e-38 30.2% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
   8::234    3e-38 29.7% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
  11::234    3e-38 31.7% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
   1::248    1e-37 29.2% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
   8::234  1.5e-36 29.2% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
   8::224  3.2e-36 29.6% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
   9::243  3.2e-36 31.5% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
   9::234  4.4e-36 29.8% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
  16::234  3.4e-35 30.2% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
  10::236    5e-34 29.0% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
  15::234  3.7e-33 28.5% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
   8::238  1.9e-32 30.9% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
   9::238  4.8e-31 31.2% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
  24::232  2.1e-30 31.2% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
   3::233  2.5e-30 30.7% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
   9::247  3.6e-30 31.8% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
   9::236  6.3e-30 32.6% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
   1::238  2.1e-29 25.6% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
   9::240  1.1e-28 29.4% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
   9::220  1.2e-28 29.5% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
   2::234  5.9e-28 33.1% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
   2::238    1e-27 27.6% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
  12::234  1.4e-27 27.6% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
  27::248  9.4e-27 26.2% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
   6::238  2.3e-26 30.9% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
   3::238  1.2e-25 28.9% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
  25::248  1.9e-24 30.8% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
  30::247  2.1e-24 29.1% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
   9::238  1.3e-23 29.3% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
   9::233  2.3e-22 28.4% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
  35::196  2.9e-22 33.8% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
  33::229  7.9e-22 27.9% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
  21::198  2.7e-21 31.2% 0047552 00475521 1/1   arboxykinase-like                       
  24::231  1.1e-20 28.7% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
  20::231  2.4e-20 26.8% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
   9::236  1.4e-19 29.3% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
   3::137  4.1e-19 29.0% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
  22::234  1.1e-18 28.0% 0053253 00532531 1/1   arboxykinase-like                       
  33::263  2.8e-18 25.8% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
  21::232    5e-18 27.4% 0047841 00478411 1/1   arboxykinase-like                       
  29::181  7.7e-18 27.0% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
  12::228  1.3e-17 31.1% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  27::230  3.6e-17 24.3% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  10::221  8.2e-17 26.9% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  25::247  1.2e-16 26.9% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
  15::224  1.5e-15 27.3% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
  33::238  1.7e-15 29.4% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
  21::188  1.2e-14 30.1% 0047844 00478441 1/1   arboxykinase-like                       
   3::244  2.6e-14 27.2% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
  12::57   2.9e-14 44.4% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
  25::246  6.4e-14 27.8% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
   4::234  9.3e-14 22.8% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
  36::244  1.2e-13 27.2% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  33::210    2e-13 27.1% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
  22::252  3.9e-13 25.9% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
  25::246  8.4e-13 27.8% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
  26::215    2e-12 26.3% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
  34::243  4.7e-12 23.5% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
  30::207  7.2e-12 25.7% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  34::230  1.4e-11 28.3% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
  34::233    2e-11 23.1% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
  23::221  3.4e-11 27.0% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  22::234  1.1e-10 27.6% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
  32::224  1.7e-10 25.7% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
  34::183  1.8e-10 27.5% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
  34::230  3.1e-10 24.0% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
  33::222  1.6e-09 24.7% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
  34::202  1.7e-09 23.3% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
  28::211  5.2e-09 27.4% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  32::231  5.6e-09 25.9% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
  24::230  9.6e-09 28.4% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  23::226  2.1e-08 20.2% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
  29::266  7.5e-08 21.0% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
  12::76   9.1e-08 33.3% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
  29::234  1.2e-07 25.9% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
  24::221  1.4e-07 28.2% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  19::221  1.5e-07 23.4% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
  34::230  1.6e-07 20.9% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  11::232  2.5e-07 25.3% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
  13::243  2.7e-07 21.2% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
  34::199    3e-07 26.9% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
  23::229  3.9e-07 24.5% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  26::220  4.8e-07 25.4% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  35::239  5.4e-07 25.1% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
  13::221  7.1e-07 20.6% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  27::233  4.4e-06 23.0% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
  36::233  5.8e-06 22.1% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
  36::260  6.5e-06 19.7% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  34::215  8.3e-06 23.1% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
  19::58   8.4e-06 32.5% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
  34::181  1.1e-05 24.6% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
  26::101  1.7e-05 27.6% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
  32::238  3.1e-05 28.2% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  21::77   3.6e-05 34.5% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
  29::217  5.9e-05 23.1% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
  34::179  6.3e-05 28.4% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
  31::184  7.4e-05 25.8% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  34::183  0.00012 35.8% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  31::220  0.00018 19.4% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
  32::72   0.00018 31.7% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
  23::211  0.00024 24.3% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  28::57   0.00037 33.3% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
  23::231  0.00042 17.7% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  24::219  0.00045 24.4% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
  34::185  0.00053 26.4% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
  34::252  0.00054 24.6% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
  29::57   0.00064 34.5% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
   1::264


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTITTRDSLLTIRGLSASVDETPILHDIDLAVGPGETHVIMGPNGAGKSTLGHVVMGDAAYRMDGGSVEF
00379581   1/1  -----lepllevenlsksyggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllk..ptsGeill
00422801   1/1  ---------llllllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsG
00367901   1/1  ---------lelknlslsyg.ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrls
00378981   1/1  --------lpllelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllk..ptsGei
00490801   1/1  ---------llllllllalllelleeeeellllllalllllgdpllelenlsksyggvpalkdvsltikp
00420701   1/1  --------lpllelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllk..ptsG
00390411   1/1  -----------MknlslrygnfralkdvslelppG.ltalvGpNGsGKStLlkalagllgp..dsglrvg
00458601   1/1  -------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagl..lkptsGeill
00510251   1/1  ---------lllllllllaeellelleeeelllllllllllllgdpllelenlsksyggvpalkdvslti
00482201   1/1  ------llllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagl..lkptsGeill
00475891   1/1  ---lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagl..lkptsGeill
00425571   1/1  ---------lelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkp..tsGeill
00500441   1/1  ---lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagl..lkptsGeill
00361211   1/1  plellgepllelenlsksyggitalddvslgirkGeivllvGpsGsGKStllrnllaglla..ptggsvl
00530591   1/1  --------llllllaleelpllgelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllk
00466971   1/1  ----llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagl..lkptsGeill
00482261   1/1  -------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagl..lkptsGeill
00404101   1/1  ----------elenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll...ptsGeill
00440861   1/1  MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKS
00502741   1/1  -------lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagl..lkptsGeill
00436071   1/1  -------pllelenlsksygg.lalkdvsltvepgeivalvGpnGaGKsTllkllagllk..ptsgeill
00372301   1/1  --------yvlPllsdgmpllelenlrkpyggllvlndvsl...pgeivaltGpnGaGKSTllrllagl.
00475991   1/1  --------lllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllag
00485451   1/1  ---------------skiygd.ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpl
00509431   1/1  ---------Mlelknlslsnfr..vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrll
00466931   1/1  --------------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpd..sGe
00469451   1/1  -------allelenlskiyggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeil
00424961   1/1  --------lgepldglgplrpapgllelenvsksygtgialidlslpigkGervalvGpsGaGKttLlrl
00503371   1/1  -----------------------Mmlkslelknfkslkdvsligdfspg.ltaivGpNGsGKStlldaia
00495371   1/1  --esalellleledltklstgikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp.....e
00498251   1/1  --------vekllglalllieklflkvlprllsllelenlskiytgipal.dvslglgGlppGeivlllG
00367481   1/1  --------yvrPelldepllelengrhPllsksyggkvvlndislsip.gellvitGPngsGKSTllral
00488521   1/1  lllllalelllevenlristgikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGei.
00468691   1/1  --------lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksygtgialidvs
00436511   1/1  --------ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgialddv
00379601   1/1  -liltledllelenlsfsyggkealkdlslaiepgelvlivGptGsGKTTllkallgllppd..egiiti
00500611   1/1  -pgllsllelllelenltklptgipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapd..sg
00496111   1/1  -----------elenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkp..tggk
00468601   1/1  --------------------------dlslevkkgevialvGpnGvGKTTllakLaglla..pqggkvll
00437981   1/1  -----lveklrpknldkvigqeealkdlslalkpgeiphalllvGppGsGKttlaralagll..gpdsgk
00495031   1/1  --lsalellleledltkistgipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglgliplg
00448931   1/1  ------------------------LddvslsvepgevialvGpnGsGKTTllnalagllapd..ggkvll
00485931   1/1  -----------------------------LsvpkgevvalvGpnGaGKTTllallaglla..ptggkvll
00422141   1/1  --------dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvl
00464791   1/1  --------lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgivlidvs
00381441   1/1  ----------------------------------GeliaivGpsGsGKsTLlklLagl..lppdsgsigs
00426051   1/1  --------------------------------kpgevialvGpsGsGKSTlakllakelglefidsgdil
00475521   1/1  --------------------evlalhgvsldve.gevvllvGpsGsGKStllralag.......sGeilv
00475371   1/1  -----------------------alddvslsikkgevialvGkgGvGKTTlaanlaglla..ptggkvll
00462761   1/1  -------------------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvv
00371631   1/1  --------mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikllle
00387201   1/1  --mssgepllevenlskryggklalkdvslsvekgeivlLlGpnGaGKTtLlralag..llgptsfvvsp
00532531   1/1  ---------------------vlalkdvslviekGevvallGlSGsGKTTLlrllagl..lipddgeili
00414121   1/1  --------------------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepd
00478411   1/1  --------------------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.......Gtil
00480471   1/1  ----------------------------sleikkgekvaivGpsGsGKSTLlnaLagl..lsptsvpett
00503741   1/1  -----------fifldlrplallplpdrlvgrdeeiealskalgg..aldgvslsiepggivllvGppGv
00490731   1/1  --------------------------dvslsvkkgkvialvGkgGvGKTTlaaklaglla..krggkvll
00379961   1/1  ---------yrpvdfddivGqeealralslalaagppegvllvGppGtGKstlaralagll..ppdsgri
00510561   1/1  ------------------------ldglgepldgllpilaklfrpievlalgllerksverlstGikaLD
00434401   1/1  --------------lsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrer..ggsvav
00457311   1/1  --------------------------------mkkgeiigivGpsGsGKSTlarllagllek.pgsgviv
00478441   1/1  --------------------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.......Gail
00437941   1/1  --lrplveklrpknlddvygqeevlkalslalekgrpehlllvGppGtGKTtlakalag..lllptsggv
00489571   1/1  -----------rvknlsksyggktalddvslsvepG.ivgLlGpNGaGKSTllrlla-------------
00468951   1/1  ------------------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgik
00368501   1/1  ---kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGppGvGKTtla
00512891   1/1  -----------------------------------evilltGppGvGKTTlakalagel..gakfgsvsl
00496571   1/1  --------------------------------GkgelivllGpsGsGKsTlarlLagll.....ggsvld
00404191   1/1  ---------------------vellpkvtlddlvgleelkealkealellslgikpgeivllyGppGtGK
00498531   1/1  ------------------------ldklgkildlalkileksflklevlalgvlerkeverlstGikaLD
00368571   1/1  -------------------------llgvrllpplppklagllplagladgdglgvllGklldgvpvtld
00533501   1/1  ---------------------------------rgeiialtGpsGsGKsTlaklLaell.phldtgdvll
00451571   1/1  -----------------------------MsikkgeiiaivGppGsGKsTlaklLakll......glivl
00475381   1/1  ---------------------------------mkgeiialtGpsGsGKsTlarlLagllk..ptsgivs
00498811   1/1  ---------------------------------kPgkiigltGpsGsGKsTlarlLae.l......gviv
00406781   1/1  ----------------------lllkdlslgippgknvllvGppGtGKTtlakalagel....gvpfvri
00513251   1/1  ---------------------iellsdlslsipspevvllvGppGsGKstlakklaell......gfili
00464411   1/1  -------------------------------vkkgeiivllGpsGsGKsTlaklLagl..lgptggsvll
00484101   1/1  ---------------------------------kgpvigivGpsGsGKTTllraLagllkpr..ggrvav
00493431   1/1  ---------------------------------kGelivllGpsGaGKsTllkllagl..lgptsgvisv
00477971   1/1  --------------------------------hkgelvvlvGPsGaGKsTLlnaLlgll..p.tsgvisv
00515531   1/1  ---------------------------------kgekvallGlsgsGKSTllnrllglefaygpTigpts
00437901   1/1  ---------------------------lslgirpgrillLyGppGvGKTtlakalakel....gapviei
00487021   1/1  -------------------------------rm...kiivltGpsGsGKsTlarlLaell......gvvv
00392701   1/1  -----------------------aledlslgirpgknvlLvGppGvGKTtlaralagll..gapfgrvda
00379261   1/1  ----------------------drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrp
00470731   1/1  ----------------------------arpltfddvvgqdeakeeleellagllgikkpkvillvGppG
00356411   1/1  -----------lknlsksygilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTigine..
00432181   1/1  ----------------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgtt
00386741   1/1  -----------------------alkavllgirpgehllLvGppGtGKTtlaralagel...........
00527261   1/1  ------------------npfilgpkvdledfigreeelkeleeal..pkivlltGprGsGKTtllkala
00489631   1/1  ---------------------------------MkgklillvGppGsGKtTlaraLaellglpf....ir
00416171   1/1  ----------diigqeeakka..llealslaartgenvllvGppGtGKttlaralak.llprsgvpfvrv
00477011   1/1  ------------eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgt
00515511   1/1  ---------------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigpte
00444381   1/1  ----------------------asdelekllelrpvlledvigqeeakkalslalelplkrlelfgkldd
00420941   1/1  -------------------------lglslgirpgkgvllyGppGtGKTtlakalagel....gapfiri
00405881   1/1  ----------------------------------gervglvGrpgaGKSTLlnaltglkaivsgypgttl
00367291   1/1  ------------vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaral
00480251   1/1  --------------------------EdlslavgkgkvialvGkgGvGKTTtaakLaa..alaergkkvl
00480441   1/1  -----------------------------------rlivllGpsGaGKsTlaklLaellp.....glivi
00513761   1/1  -----------------------------------kiiaivGkgGsGKTTllnklaglla...dggkvlv
00519581   1/1  ---------------------------------kpkvilltGppGvGKttlarlLakll.....glplii
00410321   1/1  ------------------yggllllkdlslelkkglkilllGlngaGKTTllnrllgg------------
00499191   1/1  ---------------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvdgll
00508671   1/1  -------------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLee
00439861   1/1  -------------------------------kleeveristgipeldellgGglpkgslilitGppGsGK
00495771   1/1  --------------------kkgalldilldilkgktvalvGpsGvGKStLlNaLlg..ellattgeipg
00499331   1/1  ----------------------------PslslkkgklivltGppGsGKtTlakaLaerl......glpf
00461621   1/1  ---------------------------------mkgmiialtGppGsGKsTlaklLaerlglpfistddl
00478391   1/1  ------------------------------msikkgklilltGppGsGKtTlaralaerl......glpv
00487061   1/1  ---------------------------------ldMkkgklIvieGppGsGKtTlakaLaer.gargl.d
00472911   1/1  ------------------------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddl
00482551   1/1  -------------------------------everlstgipalDellgGglppgslvliaGppGsGKTtl
00437921   1/1  ----------------------lglllveklrpkllddvvgqeealerlllalkagklphlllvGppGvG
00409841   1/1  ---------------------------lslelkkglkvalvGrpgvGKSTLlnaLlg-------------
00410531   1/1  ----------------------gelknlslelkkglkillvGlngvGKTtllkrlag.............
00394721   1/1  -----------------------aleallealrrgpprnvlLvGppGvGKTtlakalakelaag..sgpi
00476071   1/1  ---------------------------------kgkiigltGpsGsGKsTlaklLaelg...........
00532471   1/1  ---------------------------------pGkiIvitGpsGsGKsTlarlLaell.nglggivsvd
00533151   1/1  ----------------------------MsldikkgklivltGppGsGKtTlarlLa-------------


                         -         -         *         -         -         -         -:140
query           DGRDITDLSPDKRSRAGLFLSFQAPVEIPGVPLSSFLRATVAGRDGKELKGKQFKKHVRTLADELDMDPS
00379581   1/1  dglditalslaelrrrgigyvfqdpalfpgltvrenlalglllllllllllllllllalskaearervle
00422801   1/1  KSTllkllagllk..ptsGeilldgldilalslaelrr.rigyvfqdpalfp.ltvrenlalglllalll
00367901   1/1  glidlilkgllllprstvatvelifdllgllliirrlilrdgsgeilidgkdislldlrelrr.ligyvp
00378981   1/1  lldgldllllslaelllllrrgigyvfqdpalfpgltvrenlalgllla...glskaeaaaraaellell
00490801   1/1  GeivalvGpnGsGKSTLlkllagllk..ptsGeilidgkditglspqelrrlgglvlqdvllffltll..
00420701   1/1  eilldgldllllslaellalrrgigyvfqdpalfpgltvrenlalglllag...lskaeararalellel
00390411   1/1  klsdlirrgadkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrell
00458601   1/1  dgkditglspqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalral
00510251   1/1  kpGeivalvGpnGsGKSTLlkllagllk..ptsGeilidgkditglspqelrrlgglvlqdvllffltll
00482201   1/1  dgkdilglslkel..rgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgle
00475891   1/1  dgkdilglsllellrrgigyvfqdpalfpgltvlenlllgll.....llglalkeaalralllllllgle
00425571   1/1  dgldllalsl...lrrrigyvfqdpalfpgltvrenlalgllll...glskaeaaaralellellgldd.
00500441   1/1  dgkdildlsl...lrrgigyvfqdpalfpgltvlenlllgllll...glslaeaaeralelllllgl..e
00361211   1/1  ldgleisalslaerlragigyvfqdlalfpeltvlenlalg................rarellerlglai
00530591   1/1  llagl..lkptsGeilldgkditdlslkel..rgigyvvqqdallpsltvlenlllgllllgllllllaa
00466971   1/1  dgkdilglslaelllllrrgigyvfqdpalfpgltvlenlllgllllglllllaakeaalrlellllllg
00482261   1/1  dgkdildlslael..rgigyvfqqdallpsltvlenlllgllllgellllllaakeaalralllllllgl
00404101   1/1  dgldltalslael.rrgigyvfqdpalfpgltvrenlalgll........kaeararalellellgld..
00440861   1/1  tLlnaLlg..llkpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadl
00502741   1/1  dgkdilglslael..rgigyvfqqlallpsltvlenlalgllll...glskaeaaaraaellell..gle
00436071   1/1  dgldlla......lrrgigyvfqdpalfpgltvlenlalgllllgll.....ealaralellellglgdl
00372301   1/1  .llpasggilvdgedlr...........igyvfq....................................
00475991   1/1  l..lkptsGeilldgkdildlslael..rgigyvfqqdallpsltvlenlllglllagellllllaakea
00485451   1/1  lltggkvlvigldifrlsarelrkrig...vfqdpallphltvpenldlglll.........eilervle
00509431   1/1  ragglsdliflgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdislldlre
00466931   1/1  illdgkdilalspeellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllll
00469451   1/1  lldgkdvlylsleesleqlrr.rigyvfqdpalfp............................aeellel
00424961   1/1  iaglldpd..sgeilldgvdigersrevtelleelrrviglvfqdp......plfprltvaenialgaey
00503371   1/1  gllgp..dsgeirldgkdlliylsdlirrgagiayveqefdlfdgltvlenvllglgdeliirrrilrdg
00495371   1/1  vlvdgldltglspa...rggiglvfqteallppltvrenlealgldlrglld......rerviellelvg
00498251   1/1  psGsGKTtLalrllagllkp..gggvvyidgeesldll...r.arrlgvvlqelllfpeltveenl....
00367481   1/1  agll..lpasggilvpgedalll...............................................
00488521   1/1  ...............ggkvlyvdqeeslfp.ltvlenlalg..............gedveellerlgl..
00468691   1/1  ltigrGervglvGpnGaGKttLlkllagllk..pdsgeilvdGedlrelre...lrrrigyvfqdpalfp
00436511   1/1  sltikkGervglvGpsGaGKtTLlkllagllk..pdsGeilvdgligerlrevlelirelelaelrrrig
00379601   1/1  egpdel.......lrnkigyvfQdpv...lfp.ltvren...............................
00500611   1/1  eillggkvlyisleeslrrrrigmvfqelgldpdltv....................arerviellelvg
00496111   1/1  vliiglelsaeelrerr.rrigyvfqepalfpeltvlenlalgll.........................
00468601   1/1  lgaDiyraaaae..rlgigavpqdvplfpsltvldnlalar.....dlleaakaagydvvlidtaglld.
00437981   1/1  illdgkdi.........rrgiglvfqliglfphltvlelvalgl.........ggilveevrellkel..
00495031   1/1  gkvlyiglelt.lsperlrlraqsl...........................gldldellerllvidlle
00448931   1/1  vgadiarla....areqlgivfqdp....gltvlenlalg............eleararellellgledy
00485931   1/1  vgadi..........rrigavpqlpvlfprltvlenlalg..........gadlaeraeellellglegf
00422141   1/1  ielifldeeellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklrevi
00464791   1/1  lpigkGervglvGpnGaGKTtLlkllagllk..pdsgeivvyg.ligerprevrellglllelgvlf...
00381441   1/1  lttrlprlgevdgvdltfls.....reeigyvfqepallpdltvlenlylglllalllaleegkivildg
00426051   1/1  rdgvdlggesglllrdlrrl.iglvfqdpilfpgltvglllffldnidlgllirgdeeleaalelaglpr
00475521   1/1  dg.dlvdleplrr...digmvfqdpalfplltvrenvilgllelag..lskaealarvdellelvgldde
00475371   1/1  igaDirrpsarellgllgell..............................................gld
00462761   1/1  lldgddlr.......lglliglvfqdpdllpfltvlenvllpllaagliv.............ivdgtll
00371631   1/1  ellrllgklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylpaeqlk
00387201   1/1  tftlvreyelGeilldgrdlyrlsleeallllfldeileidglllvelregigyvfqdpalfpeltv---
00532531   1/1  dggdinleggfyakaigllrrkigyvfq......lfpfltvlenvalgld..glvdeedleraenllalv
00414121   1/1  fgeilidgqlledlgvlavrl.gigyvpqtlglfpaltvlellalall......................
00478411   1/1  ldg.dlvrlglkd....gigmvfqdpalfplltvrengvalglllag...lskaeieervdlllelvgld
00480471   1/1  rdfilgeilldgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllgldllllell
00503741   1/1  GKTtLakllagllkpkfgeillfgkvvyvnvselldl.................................
00490731   1/1  idaDpyrpaadellgvlaee..............................................lgld
00379961   1/1  vlvgnlsdlldpkdlrellragiplvflnfaalpasllesel............................
00510561   1/1  lllgiGglprGelvliaGppGsGKTtlalqlaanla..aqggkvlyisteesleql.rarrlgld..ldr
00434401   1/1  idlddfyrpaaelllreglgidfqlpdal........................drellreevlellgl..
00457311   1/1  idgddlyklsreelrklrrrigmvfqdpalflnpgltvrenlaeplrll.klgkk...........llep
00478441   1/1  vdd.dlvll...elrgrdilmvfqppa...lfpllevrglniaevlelaglskaealkrvdlvlelvgld
00437941   1/1  rvlgidaselld..........................................................
00489571   1/1  ----------------------------------------------------------------------
00468951   1/1  aLDlllgiGglprGelvlivGppGsGKTtlalqlaanla.klggkvlyid....teesldqlrarrlgld
00368501   1/1  ralakll....gapfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpg.tvlenlalgllv
00512891   1/1  tgrdv......rsarrgigyvfq....................................tveellgllae
00496571   1/1  tgepirgeplgelir...glvfqdpllldeltvlenlalgrylhl..glilaalaagvgvvldrvglsdl
00404191   1/1  Ttlakalanelkkr..ggrvlyvsa.............................................
00498531   1/1  allgiGglprGsltliaGppGsGKTtlalqlaanla..klggkvlyisteesleql.rarrlgld..lde
00368571   1/1  lgelgrhllivGptGsGKStllrllaglllpd.ggrviviDpkg..eyaglarglgvvildpgdgrsvrl
00533501   1/1  dgepigtp.....lgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvildrvg
00451571   1/1  dgddllreaiglvtqdgelllelidegilvpdeiv.........................iellrealee
00475381   1/1  vdglrlavlsrdllgllreglirigyvfqdyalfprltvlenvllgll......................
00498811   1/1  idgddltrelvaggglliglifqdfglfelldrellielllenlalglalegvildalrrrllelldll.
00406781   1/1  sa..................................................................se
00513251   1/1  daddlr................................................................
00464411   1/1  tgepvsgeplge....ligevfqdgilfpdltvlenvalgrygll..glikealaegvivildrvglsdl
00484101   1/1  igldigrldldellg..igylfqdvgllpvltvrenlalllrglpgysaeele...ralellelagfdvi
00493431   1/1  ggttreprpgevrgigyvfqsgalfphlivagnlleg.aevhgllygtskerveealekgllvlldr...
00477971   1/1  sg...ttrpprpgevdgvgyvfqsrelfpeltvagnfleg......aevrgnlygtsrerveelleagld
00515531   1/1  ..gtieidgvklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpslt
00437901   1/1  daselrd.............................................................vd
00487021   1/1  idtddllra..........gevfqdyalfphltvlelldnvllgleirgllkaerlervevllervgl..
00392701   1/1  sd....................................................................
00379261   1/1  gknvlLvGppGvGKTtlaralAkll....gapfvevdaselteggyvgedlekrirelfqearllvfltv
00470731   1/1  sGKTTlaralakel....gagfilidgddlrekavgeleklgr.dlfqvaregglvpdilfideidall.
00356411   1/1  gtieid----------------------------------------------------------------
00432181   1/1  rdptlgvveldgrkl......................................................v
00386741   1/1  .gapfvrlda............................................................
00527261   1/1  kel....gkpviyidlselsskgyvdleellrelaeelgell............................
00489631   1/1  idgddllrellgellgrgigf.....................gfqqgdlledatvlenlalllldeidka
00416171   1/1  ncsalte..........................................................dlles
00477011   1/1  rrptelrlsetpgltvlvvflelgerldllglvfqdfsllpelielenrala...gpiagisrdairlei
00515511   1/1  ..gtieidgvklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesll
00444381   1/1  ligrspairrllellgarpgenvlLvGppGtGKTtlakalakll....gvpfiridgselte..kelvGe
00420941   1/1  dg..................................................................se
00405881   1/1  dpnlgvveldd..............................grqlvlvDtpGlielaslgeglvrqalea
00367291   1/1  anel....gapfirvdasellek...............................................
00480251   1/1  lidlDpyrpsapeqlgilgellgvpvvgvltgldlagalrealell........................
00480441   1/1  svgdttr.epregevlgvdyvfvdrelfeelivagnlledaivhgllygtskerieealdaglgvlldgf
00513761   1/1  idlDpa........ranlpeqlgidirdlidletvmelglgpngalvfa...............leellt
00519581   1/1  dldalaellfgdvgglvvdli.................................................
00410321   1/1  ----------------------------------------------------------------------
00499191   1/1  vgvvfqddfylllpalevlengaflldlllpdaldrelllelllalve......................
00508671   1/1  pgsgvvlldgddlraglsiglilsdedraal---------------------------------------
00439861   1/1  Ttlalqlaanlakn..ggkvlyisle..esreqllera................................
00495771   1/1  dggdgrh---------------------------------------------------------------
00499331   1/1  idtddllrepvig.agtdigevfqdlllaggllvddev....................rrlllealdell
00461621   1/1  yrevvergtelgklikdyfdpgalvpd.llirlllerllfldegggflldgfprtleqaeals.......
00478391   1/1  idgddllrelvgeggrlgrdlfdedrllfrel.lideidl..............................
00487061   1/1  vvviyepvdywaavgggdllrlirelllrlg....fgepdafdnellgellealleg.............
00472911   1/1  lrglageggkpl..........................................................
00482551   1/1  al--------------------------------------------------------------------
00437921   1/1  KTtlaralarlllgs.......gggvdvieldasdlrgvddlreligevlqalglllgg...........
00409841   1/1  ----------------------------------------------------------------------
00410531   1/1  .................................................................gefv.
00394721   1/1  lldgvpvvrldlsellsv....................................................
00476071   1/1  .............................lpvidtddltregvllggpllerirellgegyllfdealdr
00532471   1/1  dlgrdvgelggaalldivde..grliglvfqdldllpllevlellaa..............rleelleri
00533151   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           YLDRELGVGFSGGEKKKLEMLQLLLLEPKLAILDETDSGLDVDALGVVSRGIDAYRRATGGALVVITHNT
00379581   1/1  llelvgldt..lldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelake.g
00422801   1/1  lglskaeararalellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetra
00367901   1/1  qdpalfpqltvlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeiee
00378981   1/1  gldd..lldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvll
00490801   1/1  ..............lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLD
00420701   1/1  lgldd..lldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvl
00390411   1/1  lnllrrrgiglvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelar
00458601   1/1  llllllgledll..drlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelake.
00510251   1/1  ................lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdlll
00482201   1/1  tlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak..gltvllvthdl
00475891   1/1  tlldrlvseLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelake.gltvllvthdl
00425571   1/1  .lldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdl
00500441   1/1  dlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdl
00361211   1/1  l...drlpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakelgvt
00530591   1/1  keaalralllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellr
00466971   1/1  letlldr.lvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelake.gltvllvt
00482261   1/1  etlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak..gltvllvthd
00404101   1/1  elldrlvgeLSgGqrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelake.gltv
00440861   1/1  vllviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdpn
00502741   1/1  dlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelake.gltvllvthdl
00436071   1/1  ...drlvseLSgGqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdl
00372301   1/1  .llervgled.lldrlpst.lsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellael
00475991   1/1  alralllllllgletll..drlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellre
00485451   1/1  llelvgldvvlldtyph.elSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldke
00509431   1/1  lrr.ligyvpqdpnllfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkelee
00466931   1/1  ellallldlllllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglg
00469451   1/1  vgle.dlldrlpge.lSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakel
00424961   1/1  frd.egadvllladsllrlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlv
00503371   1/1  rseyllnglgvslkeliellldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeel
00495371   1/1  lee.lldrlpre.lsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelgvtvll
00498251   1/1  ................................drlprllsggqrqrvvidsalalrpkllllDEPtsgld
00367481   1/1  .rvdeiltrvglsdl.ldrgls..lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallel
00488521   1/1  .dlldrlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLkrl
00468691   1/1  eltvlenlalgallag.....................lglaeyldelgkdLSgGqrqrvalAr.....pv
00436511   1/1  yvfqdpalpallrllalfpaltvaenlrfglglavlllldsatrlaqakreisalarellervglpgdlf
00379601   1/1  ...................laralrqdPdilllDEptsaldaellqallt.........ghtvvlvthhl
00500611   1/1  l.lelldrlpre.lkrsggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkrlakelgvtv
00496111   1/1  ......drlpgeldlSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrl.kel
00468601   1/1  ..ldrlvgelsggqkqrvaiarala.apevllldeptsglda.....laellelleel.gltvlvvtKlD
00437981   1/1  ............lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak..gvtvilat
00495031   1/1  lvglle.lldrlpre.lsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelgvt
00448931   1/1  dvvliDtagrlrlpselsggqkqrvaiaralaaplppevllldeptsglda.....lrellellrel.gl
00485931   1/1  dvvliDtagrgrrvgelsggqkqrvaiarallllldpelllldEptsglda.....lrlllellkel.gl
00422141   1/1  ltledlglsygdpealkdlslaippgglvlltGptGsGKtTllralagllnpd..egriltiedp.....
00464791   1/1  ............................aaellervglvaatadeppge.lsggqrqrlaiAraladdqg
00381441   1/1  dreraeellellgldadlviilpasleellerldrrgge.lsggqkqRvalarall--------------
00426051   1/1  vielllegldtlaggggvvlsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadtee
00475521   1/1  llldrlp....sggqqqeilrvaiallilpvllgralallpelllldeptsaldpdlv------------
00475371   1/1  vlvgarggdlsgglrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdat
00462761   1/1  lvglrealrkllgllsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplyga
00371631   1/1  rigllfqkglpealdveellellldlkegle...........................dilvp.vlsggq
00387201   1/1  ----------------------------------------------------------------------
00532531   1/1  gl.eeipnrypse.lsgGqqqrv...........illldEPtsgLdpvsr....................
00414121   1/1  .........lredpdlilidsgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelae
00478411   1/1  d.lldrypd.elsggqrqrvaiaralalepelllldeptsaldplavvellelllglnee..........
00480471   1/1  kelkydpvilllnkidllddrllrraeaeerieellelvgl-----------------------------
00503741   1/1  .............kellrlllealglpppyq.......lsggerlrvalaeallalgkpdllilDEitnl
00490731   1/1  vllgarggdlsgglrqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvllvvda
00379961   1/1  ..............lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegev
00510561   1/1  lllldaltveellalaerll....................................sggkvdlvviDslt
00434401   1/1  gevvivdvydlsggerqr...aralasgpdvlilDgptlgldv.............lldlpdlvifvdhd
00457311   1/1  vglpevldr.yphelsgGqrQRv...ralaldpdllilDeptsalgqpdpelrelldllifldadlgltl
00478441   1/1  .....drypyelsggerqrvailr..vllpklllpdepgrnldvliev----------------------
00437941   1/1  ........pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpk..gvtvilttn
00489571   1/1  ----------------------------------------------------------------------
00468951   1/1  lddllllpaltveellala....................................erllsggkpqlvviD
00368501   1/1  seligappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallgggrelrdge
00512891   1/1  lvglevrgeleellktlikelsggekqrvalarallakpdvlllDEid.gldpdvleallelleelk.rs
00496571   1/1  ay..gfprtlsglgqrqrvalarallkpdlvifldeppteeldeRlrkrlrlgdteevlehrleraeela
00404191   1/1  .........................delvsklsgglqeqrvaiafalarkpdllllDEidalgldpelqe
00498531   1/1  llllpaltveellala....................................erllsggkpdlvviDslt
00368571   1/1  nplalidde................edaaellralvsemgrgeddfftpaarallralilalaeepeptl
00533501   1/1  lsdlay.dgfprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelrelds.eevlekr
00451571   1/1  ldadgvildgfprllgqaell.lsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaia---
00475381   1/1  .......llgglvvildggvrqrlalarallldpdvllldeplllldaalr............dlpdlvi
00498811   1/1  .gldvvilegplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelaplygaadiv
00406781   1/1  llgkyvge.lsgglrqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrl
00513251   1/1  ............gqkqrvalleaalkegylvvvDet..gldraqrlellelardlgrpv..lviflatsp
00464411   1/1  aypgf....lsggeqqrvaiarallpkpdlvllldepteeldeR...llkRg.rllek.leyikkrlehy
00484101   1/1  lie.Gllelalplilelrelsdgqiqrvaparallrdplllll---------------------------
00493431   1/1  ........dlsggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydy
00477971   1/1  vlldidpqglsggqkqrlalaralilppsllrgldep.ealdarle.raleellelae..gfdvvivnhd
00515531   1/1  vlenlanvpillvlnKiDlleakeraeellellgl.gdlldklpse.lsgGqkqrvalaral--------
00437901   1/1  dlsg.yvgelsggeklrellaealteavlkgkpsvlllDEi.daldpdvlnallklldglrdlsgvliil
00487021   1/1  .lldrippa.lsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpe.gilpdl
00392701   1/1  .llgkyvgelsgglrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrl
00379261   1/1  lenirldaseylekrvvsrligappgyvgyglggllteavrrlpysvl..lldelekahrpirvlllsas
00470731   1/1  ........rkgpd.vildgagrtpeqlealldlleelgrpvvviiltt.nrevlldralrRpgrllldep
00356411   1/1  ----------------------------------------------------------------------
00432181   1/1  liDtpGleefa.........sggekqrvalalallreadvlllvvdadeptsfldle....llellrell
00386741   1/1  .......selsggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivgggllteldg
00527261   1/1  ellkkllkklsellglsi..lglelilglsggdleelleelaellkklgkpvililDEiqslldvsskel
00489631   1/1  ....ledggvvlldgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarl
00416171   1/1  elfghekgafgggekqrlgllrla..dggvlflDEidkl.dpdvqnaLlrvleegeltrlgggivlpadv
00477011   1/1  elpglpdltlvDtPGlgsvavvdqlsggqkqrvalarallknpdtlillved..andldtesdalellke
00515511   1/1  vlenlanvpillvlnKiDlleaklvllllvglfdlldglpse........lsggqkqrv-----------
00444381   1/1  ............................................................segailsggf
00420941   1/1  llg.kyvgelsgglrqllalara..akpsilllDEidklapkrsptsaldadvrrevlnaLlrlldglqa
00405881   1/1  leradvillvvdasdplldqpvellsggekqrlalarallgkpvilvlNKiDeptneldlellellee..
00367291   1/1  ......................lvgegegrlrgalaealradpgvlflDEidalagkrgsgtsrldpevq
00480251   1/1  ...llegydvvliDtagglqrglllalaladlllvllldepllvldatagtellelakgllealgldgvv
00480441   1/1  pr........glsqaqalrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgla
00513761   1/1  tldillealelleedydyil.iDtpGglelrallalllaiaralaadeillvddptsgldaetqleilel
00519581   1/1  ........dleaverhlldiaeellengeilildeptvgldskd...ildelakilkevnfelifithde
00410321   1/1  ----------------------------------------------------------------------
00499191   1/1  ...glvvlldryprllsggqrqrvaia.....dpdvlildg-----------------------------
00508671   1/1  ----------------------------------------------------------------------
00439861   1/1  ..............erlgldleellllgllsiliadplglsgeellrvllalalelkpdlliiDeltall
00495771   1/1  ----------------------------------------------------------------------
00499331   1/1  ..laggkvvildgfpggllqrealrrllprpdlvilldappeelleRllkrgrldgreddslellekrle
00461621   1/1  .....................kpavlsggrkqrlalara-------------------------------
00478391   1/1  ........................llakgkvvildgtnlseald--------------------------
00487061   1/1  ......................gkivlsarraqlleirlirpl---------------------------
00472911   1/1  ...gllfedaleagfrqrladlirallakgkvvild..gtglsreareellellkelg...pvlviflda
00482551   1/1  ----------------------------------------------------------------------
00437921   1/1  ..................................................kpdvlllDEi.drldpdaqn
00409841   1/1  ----------------------------------------------------------------------
00410531   1/1  dygptigvnfktvevdgvklviwDtaGqerfrsllarylrgadgillvvdatdglsfeevaklleellgl
00394721   1/1  ....sdlvg.elegglrgllteala..lakpsvlflDEidrlldardsesslevlnaLlrlledg....n
00476071   1/1  ellaallfglel.egalldglvygvlqdrllerllaagpdvlild-------------------------
00532471   1/1  ppa..............lsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslllv
00533151   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RILEHVDVDRVHVMVRGRMVAEGDSSLIESINEQGFEQFEQAGAEAAREPVAAL----------------
00379581   1/1  ltvllvthdldealrl.adrilvl----------------------------------------------
00422801   1/1  ellellrelak..gltvllvthdl----------------------------------------------
00367901   1/1  raeellellglgg.lldrpvst.LSg--------------------------------------------
00378981   1/1  vthdlsealrl.adrilvlddGri----------------------------------------------
00490801   1/1  EPtsgLDpetraellellrelake----------------------------------------------
00420701   1/1  lvthdlsealrl.adrilvlddGr----------------------------------------------
00390411   1/1  llelleglkeeaekakalleelk-----------------------------------------------
00458601   1/1  gltvllvtHdldealrl.adrilv----------------------------------------------
00510251   1/1  lDEPtsgLDpetraellellrela----------------------------------------------
00482201   1/1  sea..rladrilvlddGrivelgt----------------------------------------------
00475891   1/1  dealrl.adrilvlddGrivelgt----------------------------------------------
00425571   1/1  sealal.adrilvlddGrivelgt----------------------------------------------
00500441   1/1  sealrl.adrilvlddGrivelgt----------------------------------------------
00361211   1/1  vilvthdldlldsallrpgkrpllsdlrg-----------------------------------------
00530591   1/1  elak..gltvllvtHdlseal..l----------------------------------------------
00466971   1/1  hdldealrl.adrilvlddGrive----------------------------------------------
00482261   1/1  lseal..ladrilvlddGrivelg----------------------------------------------
00404101   1/1  llvthdldealrl.adrilvlddG----------------------------------------------
00440861   1/1  lfpglvvlisaltgegldeltvrenlalglrlrg....--------------------------------
00502741   1/1  dealrl.adrilvlddGrivelgt----------------------------------------------
00436071   1/1  dlalala.drivvl--------------------------------------------------------
00372301   1/1  gatvlfvtHdlelaall.adrvvvlndgrivav-------------------------------------
00475991   1/1  lake.gltvllvtHdlsealrl.a----------------------------------------------
00485451   1/1  lgrtiilvthdlreae...adril----------------------------------------------
00509431   1/1  eleligplldglellvglngl.ldrp--------------------------------------------
00466931   1/1  dlldrpvstLSGGerqrvalaral----------------------------------------------
00469451   1/1  gvtvilvtH.........Asdrvlvlrd------------------------------------------
00424961   1/1  eggsdpdllllDeptsalDgeivlslll------------------------------------------
00503371   1/1  lklleeleellkelekrlelle------------------------------------------------
00495371   1/1  vthdleeveel.adrvavlaggr-----------------------------------------------
00498251   1/1  plsarellellrrllrlakelgvtvllvthdldeaea---------------------------------
00367481   1/1  laellgatvlvvtHdlelaalaadri--------------------------------------------
00488521   1/1  akelgvtvllvthdldevar.ladrvlv------------------------------------------
00468691   1/1  lLllDEptsgldalre..ilellrellkel----------------------------------------
00436511   1/1  tllsrldera------------------------------------------------------------
00379601   1/1  ntaldl.adriivlddGriveegt----------------------------------------------
00500611   1/1  llvthdlreveeladkrdrvvvlrggri------------------------------------------
00496111   1/1  gvtvilvthdleeaedladsgria----------------------------------------------
00468601   1/1  gtakgghdlslalrl.adrilvlgvGeivedgtpfell--------------------------------
00437981   1/1  hdlsellpallsrcqvirfpplseeell------------------------------------------
00495031   1/1  vilvthdlrevegrleladrvvvlrggr------------------------------------------
00448931   1/1  tvlvvthlDllakggadlslalel.adrilvlgdGeiv--------------------------------
00485931   1/1  tvlvvthddgtakggaalslalel.adrilvlgdGei---------------------------------
00422141   1/1  ........ieyvfqspnlfpl.......------------------------------------------
00464791   1/1  kpvllllDEptsgldal..reil-----------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00426051   1/1  ellellerlareyerliep---------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00475371   1/1  hdldavlka.adrilvldlgg-------------------------------------------------
00462761   1/1  diviithdlsieev..adril-------------------------------------------------
00371631   1/1  kqrlalaralvedpdvlilDgptall--------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00532531   1/1  .........leladriyvllsGri----------------------------------------------
00414121   1/1  qlgltvlivlnKiDllselthdlellrela.drilvlgdgrivldgppvllls-----------------
00478411   1/1  .........ldiilalelllld------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00503741   1/1  ldpetlspdvlelLlrll----------------------------------------------------
00490731   1/1  t.lgleaadrilvlleglgv--------------------------------------------------
00379961   1/1  tieragitlll-----------------------------------------------------------
00510561   1/1  alapalelsllldeptsgldasllreilrllkrlake---------------------------------
00434401   1/1  levalerrlkrlgr--------------------------------------------------------
00457311   1/1  irlitrdlgeagrsadrvl.........------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00437941   1/1  rleeldpallsRfdviefpppdeeelleilklil------------------------------------
00489571   1/1  ----------------------------------------------------------------------
00468951   1/1  sltalrpalllldeptgellgldvrllsellrllkr----------------------------------
00368501   1/1  llkalkeaeaeellellglk..dl----------------------------------------------
00512891   1/1  gvtvilttndldel.eladriallrrgrivelgp------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00404191   1/1  ellelldelaer.gvtlilttnnrpeeldqallrllsrldrv----------------------------
00498531   1/1  alapslllldepgrvtqgldarllreilrllkrlak----------------------------------
00368571   1/1  delle-----------------------------------------------------------------
00533501   1/1  lehylellekad..rvvvidaggsleevveeil-------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00475381   1/1  fldadpeelleRllkRg..r--------------------------------------------------
00498811   1/1  idndlsleev..vdrilallegl-----------------------------------------------
00406781   1/1  lsgvtviattn-----------------------------------------------------------
00513251   1/1  evlierlldrvllldegslvdlgv----------------------------------------------
00464411   1/1  lelaepyk.ddvvv--------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00493431   1/1  vivnddleealeelldiivv--------------------------------------------------
00477971   1/1  leealelldril----------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00437901   1/1  t---------------------------------------------------------------------
00487021   1/1  vifldadpeell....eR..l-------------------------------------------------
00392701   1/1  lsgvtviattnrpeeldpal--------------------------------------------------
00379261   1/1  lvlllgglglpevgel------------------------------------------------------
00470731   1/1  ..eldppdreerleilkrllkklg.tvldvthddelarladr........gtlvli--------------
00356411   1/1  ----------------------------------------------------------------------
00432181   1/1  lagkpvilvlnKiDlldareelak----------------------------------------------
00386741   1/1  lllpsgvlvia-----------------------------------------------------------
00527261   1/1  leaLlrlldeg-----------------------------------------------------------
00489631   1/1  eeryradlvivtddl.....--------------------------------------------------
00416171   1/1  rliaatnpdllelvlegelrpa------------------------------------------------
00477011   1/1  lleegkrtivvvtKiDlldkgeevldilrglli-------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00444381   1/1  kqrvgia..lladpgilfl---------------------------------------------------
00420941   1/1  lsnvtviatt------------------------------------------------------------
00405881   1/1  ......lggtvvlvSahdgegldelldai-----------------------------------------
00367291   1/1  naLlrlleelr-----------------------------------------------------------
00480251   1/1  ltkldlvaalgaalsvalilglp-----------------------------------------------
00480441   1/1  dvvivnddleea.lelllailla-----------------------------------------------
00513761   1/1  llelllklgipiilvlnKlDllseeglelvlelleellellpilllgvgp--------------------
00519581   1/1  delre-----------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00439861   1/1  daervrelrellralkrlakelgvtvil------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00499331   1/1  ryeeltr---------------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00472911   1/1  dpevlleRll------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00437921   1/1  a---------------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00410531   1/1  aglegvpiilvgnKlDlldal-------------------------------------------------
00394721   1/1  vlviattnr-------------------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00532471   1/1  lplpdlviyldadpeell....eRllkRgrdpeeqe.rlddl----------------------------
00533151   1/1  ----------------------------------------------------------------------