[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV56234.1


[Show Plain Result]

## Summary of Sequence Search
   1::144
   1::144  4.5e-40 34.8% 0050992 00509921 1/1   NifU                                    
   1::139  1.2e-37 33.8% 0043760 00437601 1/1   NifU                                    
   7::143  3.9e-29 37.1% 0050511 00505111 1/1   NifU                                    
   3::144  6.2e-29 34.7% 0042614 00426141 1/1   NifU                                    
   1::144


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASIYTAALMEHNAHPDYKYQMDEPTCTHDGVNPSCGDELTLSLRLRGDRIEEAAFTGHGCAVSQAAADM
00509921   1/1  llllldlddlysevildhaknprnvglledada.aevgnplcGDtvtlylkvddgriedakfegfGCais
00437601   1/1  lddlysekildhalnprnvglledada.aevgnplCGDtvtlylkvddgritdakfegfGCaisiAsasl
00505111   1/1  ------ekildhalnprnvglledadllvatgevgnplcGDtvtlylkvdedgvIedakfkgfGCaisiA
00426141   1/1  --dlYsekildhylnprnvglledadallatgevgnplcGDvvtlylkvdddgiitdakfkgfGcaiaiA


                         -         -         *         -         -         -         -:140
query           MADLVTGETVGEARRLSGLYLDMIKGRPLTDEERADLDEAAELESIARMPARVKCAELAWRTLEKLLDQQ
00509921   1/1  iAsaslltelvkgktleealellnefiamllgglppdeal..lgdlavlagvrkypaRikCalLawdalk
00437601   1/1  ltelvkgktleealkllnkfiamllgglppeedl..lgdlavlagvrkypaRikCalLawdalkealed-
00505111   1/1  saslltelvkGktleeale.....................lgdldvlealglpparihcalLawdalkaa
00426141   1/1  saslltelvkGktleealk.....................lgdldilealrlpparlkcallaldalkea


                         +         -         -         -         -         *         -:210
query           LEKA------------------------------------------------------------------
00509921   1/1  eale------------------------------------------------------------------
00437601   1/1  ----------------------------------------------------------------------
00505111   1/1  led-------------------------------------------------------------------
00426141   1/1  ledy------------------------------------------------------------------