[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV56703.1


[Show Plain Result]

## Summary of Sequence Search
   1::471
  14::471    2e-54 23.7% 0042501 00425011 1/1   eneral substrate transporter            
   5::471  9.3e-51 23.6% 0042480 00424801 1/1   eneral substrate transporter            
   1::471


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRWWETEGRRHAGMKRVKSERMGVYALFAIVVLASASGNLSQTAVNAMLGDIMLQFGLTVDLGQWLTTSY
00425011   1/1  -------------Msdsssseeddpelprpllrrrrwrillllflgyflagldrsiigpalpll.edlgl
00424801   1/1  ----Mkekrrrv...............llllflgyflsgldfgligpllplilkdflglsaaqigllfsa


                         -         -         *         -         -         -         -:140
query           MLVLGITVPVATFLSRRFSVRQHVFIALAFFLVGALADLFAPNFGVLLAGRVFQAISTGMLMPLMQTIAM
00425011   1/1  saaqaglllsafflgyalgallaGplaDrfGrrrvlllglllfalgslllalaallgpslalllllrflq
00424801   1/1  yllgaalgsplaGrlsDrfGrrkvlllglllfalgslllafaptystslwlllllrflqGlgagglfpaa


                         +         -         -         -         -         *         -:210
query           TRFPRGRQATAMGVAGIAMGFAPNIGPTIGGAMSFSLGWRSFFVLLVVIMLALAAAAAVAIKPSAAPDKS
00425011   1/1  GlgagglfpaalallaewfppkergralglfgaggglGgalgpllggllleldlgWrwafliaailalll
00424801   1/1  laliaelfppeerglaleygllsaggslGallgpllggllld.lgwrlvfliaailalllllllllflpe


                         -         -         -         +         -         -         -:280
query           ARLDVVSLAQSTLGFGGLLLAFSNASSFSFESPFIWAPLVLGALFLVLFVRRQKRVDDPLISMDIFSSRQ
00425011   1/1  alllllllpesprflllkglseeerkvlerrlkad...................................
00424801   1/1  sprflaakgklee................................................ekkaslkls


                         -         *         -         -         -         -         +:350
query           YRAGFIAQNLLNASFMGVTLIVPLYVEGLCGGTALEAGVVLLPGTVAALVLNPLAGVLTDKVGVRPVALV
00425011   1/1  ................aeakaasplsllellrnprflllllayfllflgfyglltflplylqevlglsas
00424801   1/1  lkellknprllllllavfllflgfyalltylplylqslfevlglsasqaglllalfglggilgsllagrl


                         -         -         -         -         *         -         -:420
query           SGAFLATGAVLMSFLDADTPLYVTTLCQAVRAVGVSGLVGPLTSWSLAQLPRPIVADGSSFCISARQACA
00425011   1/1  qaglllalfglggilgsllagrlsdrlpegrrrrllliglllaalgllllall.pgtslallllllfllg
00424801   1/1  sdrlgrrrllligllllalgllllal..ap.slwllllllillgfgfglafpllfallselfppelrgta


                         -         -         +         -         -         -         -:490
query           SLGTSVMVFLIAVAGASAAGLANPALAYQLAFGFSAVMAVATLGFIVAKVR-------------------
00425011   1/1  fglggafpllfalvaelfppelrgtasgllnlagnlggallgpllagllld-------------------
00424801   1/1  lgllnllagslggalgpllagllldal............gysaaflllaal-------------------