[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV56840.1


[Show Plain Result]

## Summary of Sequence Search
   1::435
   1::272  1.1e-93 49.8% 0045781 00457811 1/1   ropteroate synthetase-like              
  14::272  1.1e-90 52.9% 0046651 00466511 1/1   ropteroate synthetase-like              
   1::272  6.4e-88 48.5% 0049727 00497271 1/1   ropteroate synthetase-like              
  13::272  1.5e-85 51.4% 0045762 00457621 1/1   ropteroate synthetase-like              
   1::274  4.8e-64 43.6% 0048901 00489011 1/1   ropteroate synthetase-like              
  14::274  6.6e-58 31.0% 0046719 00467191 1/1   ropteroate synthetase-like              
 270::417  2.6e-39 50.7% 0046104 00461041 1/1   roxymethyl-7,8-dihydropterin pyrophosph 
 271::416  9.4e-39 51.5% 0046736 00467361 1/1   roxymethyl-7,8-dihydropterin pyrophosph 
  13::216  2.6e-05 23.7% 0045046 00450461 1/1   in phosphate synthase                   
   1::435


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIWRCATYEFDTRMPIVMGILNVTPDSFSDGGQHDGFDAALAHAERMAEEGARIIDVGGESTRPGAAPVS
00457811   1/1  lllllgllllllsrtlvmGilNvTpdsfsdggrfldleaalaralelveeGAdiiDiGgestrPgaelvs
00466511   1/1  -------------rtlvmGilnvtpdsfsdggrfldldaalaralelveeGAdiiDiGgestrPgaelvs
00497271   1/1  lllllsllggllllllsrplimGilnvtpdsfsdggrfldleaaleralelveeGAdiiDiGgestrPga
00457621   1/1  ------------dltlimgilNvtpdsfsdggkfldleaaleralelveeGAdiiDiGgestrPgaalvs
00489011   1/1  lsllgglklgldsrtliiGEilNvtpdskfsdgikeldleaalelareqveaGAdiiDigggstrp....
00467191   1/1  -------------flligerlNvtgdkfseailegdleaalelAreqveaGAdiiDvnvgstrp......
00461041   1/1  ----------------------------------------------------------------------
00467361   1/1  ----------------------------------------------------------------------
00450461   1/1  ------------iimllkriylildv.........diedllelaeaaleaGadaiqlrvkdpspe.....


                         -         -         *         -         -         -         -:140
query           VDEELARVLPVVRALAQRDVCVSIDTRHAEVARACLEAGAAIVNDVSGFRDPAMVDAVRDSDCGLVVMHM
00457811   1/1  leeelervlpviealrelldvpisiDTykaevaeaaleaGadiiNdvsglldpellevvakygapvvlmh
00466511   1/1  leeeldrvlpviealreldvpisiDTykaevaeaAleagadiindvsgltldpellplvaeygapvvlmh
00497271   1/1  alvsleeelervlpvvkalaeevdvpisiDTskaevaeaAlkagadiindvsgleldeemlplvakygap
00457621   1/1  eeeelervlpviealrdldvpisiDTlkaevaeaAlkaGadiiNdvsgleldpelldlvakygapvvlmh
00489011   1/1  ....eelervvpvleavaeavdvPlsiDtskaevaeaalkavkgadiiNsvsggdidlpevaplvaeyga
00467191   1/1  ..delermvpvvellaeevdvplsiDsskpevieaaLkavqgkplinsvsleeekleevlplaakygaav
00461041   1/1  ----------------------------------------------------------------------
00467361   1/1  ----------------------------------------------------------------------
00450461   1/1  ..gllelaeaikelakkvdvplivndg....velaleagadgvhlgg...pdllleaarelglgvivgv.


                         +         -         -         -         -         *         -:210
query           QGDPSTMQNAPSYDDVVADVREWLRDRAAALEAAGVAHDRICIDPGPGFGKTPSQTLELVRNFQEFVRLG
00457811   1/1  mrgdpltmqalpdyddvveevlafleerielaleaGikrediilDPgigfgktleqnlellrrlellkel
00466511   1/1  mrgepitmqallplyddvveevlafleerieaaleaGikrediilDPgigfgktleqnlellrrleelka
00497271   1/1  vvlmhmdgdpq.......yddvveevlefleelielaleaGiprediilDPgigfgktlehnlellealr
00457621   1/1  mrgtpl.......yddvveevlafleerielaleaGikreriilDPgigfgktlehnlellrrlellrll
00489011   1/1  avvvmhldg.........gypdtveerleileelielaeeaGip.ediilDPgigfvktgehnlelleal
00467191   1/1  vvlaldeeg........iadtaeerleiakrlvelaveaGippediilDPlvlpvktgienaletleair
00461041   1/1  ----------------------------------------------------------------------
00467361   1/1  ----------------------------------------------------------------------
00450461   1/1  ......................svhtleealeaeelgadyillgpvfptgtkpgfgplglellrelveav


                         -         -         -         +         -         -         -:280
query           YPVMVAVSRKSFLGWAYGIDEPSARDEVSAAEALMACELGASVVRAHNVAATVAALEGLRPYALIGMGCN
00457811   1/1  glplllGvSrksfigallglp.vrerllgtlalaalaallgadilrvhdvaetvdalkvada--------
00466511   1/1  lglplllGvSrksfignllglldadslpvrerlagtlaaaalaallgadilrvhdvaetvda--------
00497271   1/1  llkelglplllGvSrksfigallglplp.erlagtlallalailagadilrvhdvketvdal--------
00457621   1/1  glplllGvSrksflgdllglgvpleerlagtlallalaillgadilrvhdvaetvdalkvld--------
00489011   1/1  relkelglpvllGvsrksfgl......pvrerlngtflalaiaaglgaaivrvhdvaltadile------
00467191   1/1  likellllgvpvllGlSnvsfgl......pvrellnstflalaiaagldaaIvnvhdvllmddi------
00461041   1/1  -----------------------------------------------------------mllvyialGsn
00467361   1/1  ------------------------------------------------------------llvyialGsn
00450461   1/1  ..kipv----------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           VPLVASPGEEREGKIAMLNQAITELCSLPDSQIVDISSFYESEPAYYLDQDSFVNAVVLLRTGIPPKELL
00457811   1/1  ----------------------------------------------------------------------
00466511   1/1  ----------------------------------------------------------------------
00497271   1/1  ----------------------------------------------------------------------
00457621   1/1  ----------------------------------------------------------------------
00489011   1/1  ----------------------------------------------------------------------
00467191   1/1  ----------------------------------------------------------------------
00461041   1/1  l..........gdrlallraalalLaellgilvlavSslyetepvgfldqpdflNavvlletslsplell
00467361   1/1  l..........gdrlallraalalLaellgilvlavsslyetepvgfldqpdflNavvlletslsplell
00450461   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GYLHAVENSLGRVREVRNGPRTCDLDILDYQLYVVDADVLTLPHPRLLERDFVVQPLLELLPGHVLANDV
00457811   1/1  ----------------------------------------------------------------------
00466511   1/1  ----------------------------------------------------------------------
00497271   1/1  ----------------------------------------------------------------------
00457621   1/1  ----------------------------------------------------------------------
00489011   1/1  ----------------------------------------------------------------------
00467191   1/1  ----------------------------------------------------------------------
00461041   1/1  dllkaiElelgRvrllrwgpRtlDlDillygdlvldtedltlPhprllerafvlvPlaelapdlvlp---
00467361   1/1  dllkaiElelgRvrlalrwgprtlDlDillygdlvldtedltlPhprllerafvlvPlaelapdlv----
00450461   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           PVSVDGVTVGKSVRL-------------------------------------------------------
00457811   1/1  ----------------------------------------------------------------------
00466511   1/1  ----------------------------------------------------------------------
00497271   1/1  ----------------------------------------------------------------------
00457621   1/1  ----------------------------------------------------------------------
00489011   1/1  ----------------------------------------------------------------------
00467191   1/1  ----------------------------------------------------------------------
00461041   1/1  ----------------------------------------------------------------------
00467361   1/1  ----------------------------------------------------------------------
00450461   1/1  ----------------------------------------------------------------------