[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV56911.1


[Show Plain Result]

## Summary of Sequence Search
   1::191
   1::191  4.3e-46 31.9% 0051163 00511631 1/1   e-like                                  
   1::173  1.8e-32 30.8% 0046909 00469091 1/1   e-like                                  
   4::181  1.5e-28 25.1% 0041687 00416871 1/1   e-like                                  
   1::180  4.5e-27 27.3% 0040356 00403561 1/1   e-like                                  
  21::178    1e-24 26.9% 0036900 00369001 1/1   e-like                                  
  25::181  1.7e-24 21.7% 0048249 00482491 1/1   e-like                                  
   2::175  3.2e-24 30.1% 0051755 00517551 1/1   e-like                                  
  27::176  4.7e-23 24.0% 0048919 00489191 1/1   e-like                                  
   1::179  2.5e-21 27.3% 0041991 00419911 1/1   e-like                                  
  25::181  2.6e-21 24.7% 0050136 00501361 1/1   e-like                                  
  26::183  1.8e-20 25.0% 0041576 00415761 1/1   e-like                                  
  23::156  1.5e-19 23.3% 0035791 00357911 1/1   e-like                                  
  21::174  3.5e-18 26.0% 0034851 00348511 1/1   e-like                                  
  27::181    5e-18 29.4% 0041997 00419971 1/1   e-like                                  
  22::165  4.8e-17 22.0% 0047030 00470301 1/1   e-like                                  
  20::175  6.8e-17 23.4% 0041489 00414891 1/1   e-like                                  
  21::175  2.8e-16 25.5% 0050349 00503491 1/1   e-like                                  
  25::165    7e-16 22.1% 0050151 00501511 1/1   e-like                                  
   1::156  7.9e-16 21.9% 0036560 00365601 1/1   e-like                                  
  19::157  1.5e-15 23.5% 0044334 00443341 1/1   e-like                                  
  22::176  5.9e-14 23.4% 0038588 00385881 1/1   e-like                                  
  16::156  8.9e-14 23.4% 0048678 00486781 1/1   e-like                                  
  23::158  1.3e-12 21.3% 0038017 00380171 1/1   e-like                                  
  24::175  4.3e-12 28.1% 0048493 00484931 1/1   e-like                                  
  21::176  5.5e-10 28.8% 0050105 00501051 1/1   e-like                                  
  23::160    7e-09 18.8% 0051301 00513011 1/1   e-like                                  
  31::182  3.2e-08 25.9% 0047309 00473091 1/1   e-like                                  
  23::156  5.6e-06 19.5% 0046155 00461551 1/1   e-like                                  
  35::173  5.6e-06 24.4% 0035468 00354681 1/1   e-like                                  
  25::156  6.2e-06 17.6% 0046852 00468521 1/1   e-like                                  
  40::171    1e-05 22.2% 0051105 00511051 1/1   e-like                                  
  18::147    6e-05 22.3% 0042536 00425361 1/1   e-like                                  
  50::189   0.0002 23.1% 0049833 00498331 1/1   e-like                                  
  48::166   0.0003 20.2% 0052114 00521141 1/1   e-like                                  
   1::191


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MELLEERIRRDGVVKSEGVLKVDSFLNHQLDIDLFDAMGEEFKRLFADAPITKILTIEASGIGIACVVAR
00511631   1/1  lkellelireigalpkggfllfidilsllldpellrllgellaerlaglkidvvvgveagGiplaaalar
00469091   1/1  lvaelllelladriltvglfplksglyfditkllldpelllelarllaeeiaellpgldidvvvgiergG
00416871   1/1  ---lvakllldagalkfgiftlpsgpisgifvdllkllvdpellrrlaeelaeriagldidvvvgvprgG
00403561   1/1  dlllelladriltvglfgkpgflyid.ilkllgdpellrlladllaerlkdldidvvvgiprgGfplaaa
00369001   1/1  --------------------qiigffkydvdpllgrllaeelaerlkdldidvvvgvprgGiplaaalar
00482491   1/1  ------------------------cavipylgyarqdrcakclehplaklklrflldsgkpsiifidllk
00517551   1/1  -Pitaklvadlllelladriltfglftlksglqspgffdirvllldpellrllarllaelikdlgleidv
00489191   1/1  --------------------------taviPylgyarqdrkllpleaisaklvgrfildsgkksiifvdl
00419911   1/1  rvltldlllkqirffldspvdgllyidit.kllldpellrelarllaeelaellpleidvvvgiprgGfp
00501361   1/1  ------------------------elleldllkfgdfvltyglhsdsyidffkvlvdpellrrlarllae
00415761   1/1  -------------------------ltllldpeqiqalidelaeklkelykidvvvgvlrgGlplaaala
00357911   1/1  ----------------------dlhagqilgffdfpldslcispyyyddrpdllldpeliyelvrrlaee
00348511   1/1  --------------------fsdilldgllirdlarlladeiaerlkglkpdvvvgilrgGvplaaalar
00419971   1/1  --------------------------epitakllaellleagalrvgefdlhsgqispiffdikvlldpe
00470301   1/1  ---------------------rcifedlyfarpdsffdgpvvylllarllaelarel.dleadvvvgvpl
00414891   1/1  -------------------diipllldyevirelgrllaeeiaerlkglkpdvvvgiprgGfplaaalar
00503491   1/1  --------------------rpdvlldgedirelgrllarelaedlalllveveglkpdvvvgiprgGvp
00501511   1/1  ------------------------ifkllvdpelilrlgrllaeeikdlkpdvvvgvprgGfplaaalar
00365601   1/1  lrepitaklvadlllragadflipgdlhvdisdlllswevikalirelaeeiaedykdgvepdvivgvlr
00443341   1/1  ------------------gaqsdiffdgelvrdlarllaeeiaerlkgldpdvvvgiprgGvplaaalar
00385881   1/1  ---------------------yldffkllvdpeliralarllaeeilelyggepdvvvgvprgGvplaaa
00486781   1/1  ---------------PkpyiafrdilldlleirealrrlaellaerlkglelldlgkpdvvvgilrgGvp
00380171   1/1  ----------------------YfdiqgllidpedilaaiellaeeiaeklkgglepdvvvgvprgGvpl
00484931   1/1  -----------------------lfdlpvddlealtplaeelaell.dlkidvvvgilrgGlplaaglar
00501051   1/1  --------------------krasaldiplvipyltylrddrtpgirfrdladrlatlllhealfdlpvd
00513011   1/1  ----------------------lhyfdiqklllspedileairllaeeiaedlgg.kpdvvvgvlrgGvp
00473091   1/1  ------------------------------dipvdtplaelllalr.glkqlvvvgilrgGvplaaalar
00461551   1/1  ----------------------rqdrklcgrelisaklvadllallgydfvltsdlhslkyqdifillvd
00354681   1/1  ----------------------------------fdtpvdnlyagvldldnlvvVsilrgGvllaaalak
00468521   1/1  ------------------------Pylgyarqdrkclpgepisaklvalllylagldrlltsdkhsgqlq
00511051   1/1  ---------------------------------------tligellkdlkklvvvsilrgGlplaaglar
00425361   1/1  -----------------ydrlldvllseeqiqgfidiladelaedyllldyiglepdvvvgvlrgGvvfa
00498331   1/1  -------------------------------------------------d.dvvvgvdrggvplaaglad
00521141   1/1  -----------------------------------------------dlendvvvgpdrggvpraaalad


                         -         -         *         -         -         -         -:140
query           HFGVPVVFAKKAQSINLDGEMFTTRIESFTHGRVYDVIVSKKFLNADDHVLIIDDFLANGCALNGLIELV
00511631   1/1  algvplvfvrkegklhgegrtiegsvysrleygvdllllsldallkgkrVlivDDvlatGgTllaaiell
00469091   1/1  iplaaalaralgvplvlvrkkgklhgt....tlsveyrlenvegalklpkdalvkgkrVllVDDvlaTGg
00416871   1/1  iplaaalaralgvplvivrkkaklpg.ddtlsvgyvlerstgvleillilgalvegkrVllVDDviatGg
00403561   1/1  laralgvplvivrkkrk..lpvqvills.yeleygldvafelklpadvkgkrVllvDDvlaTGgTllaai
00369001   1/1  algvplvivrkrrk..yygrtqiglgreerekgvrlkllpldadvkgkrVllVDDviatGgTlraaielL
00482491   1/1  llgdpellealadllaelikellldidvvvgvplrGfplaaalalrlglplvivrkkrklpgtrvtiegl
00517551   1/1  vvgpdagGiplaaalalalgvplvfvrkerk...............ghgeve...liegalvkgkrVliv
00489191   1/1  rkllsdpellllladllaelikelllkidvvvgvelgGiplAaalalrlglplvivrkrrklpgttvvie
00419911   1/1  laaalaralgvplvlvrkrrk....lpgttlsreerlenlkvalelslgadvegkrVllVDDvlaTGgTl
00501361   1/1  rlkd.didvvvgvplgGfplaaalaralglplvivrkrrkyvlpgfiglss.ysrdygvggalellkgll
00415761   1/1  ralgvplvivrkvgkyp..............etgnvklvldldadvegkrvliVDDiidTGgTllaaael
00357911   1/1  laeklgg.kpdvvvgvprgGvplaaalaralgvplvivrkrrklpvdflsvssyvgrtliegnvilrlrl
00348511   1/1  algvplvivrkvgk..lgvtsytddqyalergegnliigfdlpgdvkgkrVllVDDviaTGgTlraaidl
00419971   1/1  llralgrllaelirelgldidvvvgvplgGiplaaalaralglplnrgvpfvfirkerk...........
00470301   1/1  ggiplAaalaralgiplaivlkrnryv..grtfirpsqelrekgvrvklnalvglveGkrVllVDDvitt
00414891   1/1  alglpl.........ggklpvgfvrkerylegglsrlerlknvlgafklpadlkgkrVllVDDvitTGgT
00503491   1/1  laaalaralglplvlvrklgvlg....itfyrdeqkllgrgavleglklpfdvegkrVllVDDvltTGgT
00501511   1/1  algiplvivlkrrkytgetlelggvvllln..........ldgdvkgkrvllVDDvidTGgTlraaaelL
00365601   1/1  gGlpfaallarelgvplavdrkrvksygg..........trstgelkilkdldgdlegkkVLiVDDiidt
00443341   1/1  alglplvivrkvgkl..grtryrdeqkelslgerl.kllrlpadlkgkrVllVDDvidTGgTlraaielL
00385881   1/1  laralgvplvivrkrrksygd....terrgnvkilk......dlpgdvegkrVllVDDvidTGgTlraaa
00486781   1/1  laaalaralgllgvpvplgfllvssyrdet.................relgvvrlleglpadvkgkrVll
00380171   1/1  aaalaralgvplaivrkrrksyggtfslsgeleilldlrg.........dvkgkrVllVDDvidtGgTlr
00484931   1/1  alpgaplgfirkrr......kgatlgpvleygklpgdv........kgkrVllvDDviaTGgTllaaiel
00501051   1/1  dlealtplaeelaelr.glkqlvvvgilrgGvplaaalaralpgaplgiirkrrk.............ey
00513011   1/1  laaalaralglplavgfkrrksygddlstlgeverlkdlpg.........dvegkdVllVDDvidTGgTl
00473091   1/1  alpgaplgfvrkrrklp......glgpvleylllpgdv........egrrVllvDDvlaTGgTllaaiea
00461551   1/1  ilallailaaiiekdl.gpkplvvvgilrgGfpfaaalarelglplviirkvgklprvtvtisqsslygk
00354681   1/1  llgdaplgfilirrdek........tlepvlyylklpgdv........kgrrVllvDdmlaTGgTllaAi
00468521   1/1  lalisaeeileairelaeeieddi.gpkplvvvgilrgGfnfaallaralglpliiilkvdllprvrlti
00511051   1/1  llpsapvgfilirrygetvvevllelepvlyylklpgdil......kgknVllvDdmiaTGgTllaaiel
00425361   1/1  adlaralgllglplpldfidksryggdtsslg.....nvvivkdlig....dvegkhVllVDDiidtGgT
00498331   1/1  llglplavlrkrry...............edgvvrklnlvgdv..kgkrVllvDDiidtGgTllaaadaL
00521141   1/1  alglplavvlkrrkragvvpilragllrldgvllllsylrelerlgnveellrlvgdvkgrtVllVDDii


                         +         -         -         -         -         *         -:210
query           GEAGATVEGIGIAIEKGFQPGGDDLRERGYRLESLAIVERMDPETGEIAFR-------------------
00511631   1/1  keaGakvvgvavlidkpelggreklvgagvpveslvgldlllnelvrilpg-------------------
00469091   1/1  TllaaaellkeaGakvvgvavlvdrpegggrel-------------------------------------
00416871   1/1  TlraaielLreaGakvvgvavlvdk..pggrellilpdvpv-----------------------------
00403561   1/1  elLkeaGakvvgvavladrpllslggrerlveagvdvvil------------------------------
00369001   1/1  reaGAkvvgvavlvdkpsgpafegidlsgreeliatgt--------------------------------
00482491   1/1  ylselergpnllllklpalvkgkrVllvDDvltTGgTalaa-----------------------------
00517551   1/1  DDvitTGgTllaaaellkeaGaevvgvavlvdlls-----------------------------------
00489191   1/1  llyryeleygavtlelklgalvkgkrVllvDDvlaT----------------------------------
00419911   1/1  raaaelLkeaGakvvgvavlvdkpeggarlrl..egvdv-------------------------------
00501361   1/1  gdvegkrVllVDDvittGgTlraaaelLkeaGakvvgvavl-----------------------------
00415761   1/1  lkeagakvvgvavlldkppdyagerlpdefvvlytldlaeklr---------------------------
00357911   1/1  dgdvkGkrVllVDDvi------------------------------------------------------
00348511   1/1  Lkeagrakvvgvavlvdkp..egrkrlradyvgv------------------------------------
00419971   1/1  ....eyg..evvllig..lvkgkrVllVDDvittGgTlraa-----------------------------
00470301   1/1  GtTlraaaeaLreaGAkevhvavlv---------------------------------------------
00414891   1/1  lraaielLreaGrakvvgvavlvdkp..egrakll-----------------------------------
00503491   1/1  lraaidaLreaGrakvvgvavlvdrp..egrkpla-----------------------------------
00501511   1/1  keagakvvkvavlvdkpsgparpdl---------------------------------------------
00365601   1/1  GgTllaaaelLkeaga------------------------------------------------------
00443341   1/1  reaGrakvvgvavlvdr-----------------------------------------------------
00385881   1/1  elLkeagakvvgvavlvdkpsggaelklkpdyvgle----------------------------------
00486781   1/1  VDDviaTGgTlraaie------------------------------------------------------
00380171   1/1  aaaelLkeagakvvgvav----------------------------------------------------
00484931   1/1  LkeaGakvvivavlvar..pegldrlgaagpdvvi-----------------------------------
00501051   1/1  glgpvliyldlpgdv.egrrVllvDDvlaTGgTlla----------------------------------
00513011   1/1  raaaeaLkeagaksvkvavl--------------------------------------------------
00473091   1/1  LkeaGakvvgvavlvd..apegldrlgeavpdvvvvtatidl----------------------------
00461551   1/1  trsegvvvilldldgd------------------------------------------------------
00354681   1/1  elLkelGakvvriavlhllasgegierlleafp-------------------------------------
00468521   1/1  tqssyyrktrskgvvv------------------------------------------------------
00511051   1/1  Lkkagpkriivavllaapegldrlgeafpdv---------------------------------------
00425361   1/1  lraaael---------------------------------------------------------------
00498331   1/1  reagAkevhaavlhpvlagpaverldgaaidelvvtdtieeiln.vlsv---------------------
00521141   1/1  dtGgTliaaaelLkeaGakevyvavt--------------------------------------------