[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for elen0:ACV56973.1


[Show Plain Result]

## Summary of Sequence Search
   1::219
   1::154  3.1e-57 46.8% 0042562 00425621 1/1   S ferredoxins                           
   1::190  6.5e-49 40.4% 0044015 00440151 1/1   S ferredoxins                           
   3::155  6.4e-48 45.1% 0038361 00383611 1/1   S ferredoxins                           
   3::154  3.1e-36 36.7% 0040210 00402101 1/1   S ferredoxins                           
   1::145  2.2e-34 36.6% 0038466 00384661 1/1   -helical ferredoxin                     
   3::160  4.4e-26 38.6% 0038470 00384701 1/1   S ferredoxins                           
  58::164    2e-25 38.7% 0053368 00533682 2/2   S ferredoxins                           
   6::128    3e-22 37.1% 0052928 00529281 1/1   S ferredoxins                           
  57::158  1.2e-20 35.3% 0039666 00396662 2/2   S ferredoxins                           
   3::152  2.5e-20 33.3% 0052774 00527741 1/1   S ferredoxins                           
   3::127  4.3e-19 45.7% 0039142 00391421 1/1   S ferredoxins                           
  58::135  6.3e-18 35.1% 0035446 00354462 2/2   S ferredoxins                           
  53::153  1.2e-17 37.0% 0045037 00450372 2/2   S ferredoxins                           
   1::147  2.3e-17 41.7% 0045859 00458591 1/1   S ferredoxins                           
  64::153    6e-15 39.5% 0047184 00471842 2/2   S ferredoxins                           
   3::129  1.1e-14 23.5% 0048346 00483461 1/1   -helical ferredoxin                     
  58::133  2.3e-14 32.0% 0047149 00471492 2/2   S ferredoxins                           
   4::115  4.9e-13 37.8% 0052034 00520341 1/1   -helical ferredoxin                     
   1::127  9.3e-13 28.9% 0047791 00477911 1/1   -helical ferredoxin                     
  89::155    2e-12 37.9% 0052779 00527792 2/2   S ferredoxins                           
  92::152    1e-11 41.7% 0035614 00356142 2/2   S ferredoxins                           
  90::153  1.3e-11 47.5% 0049159 00491592 2/2   S ferredoxins                           
  58::116  1.6e-10 40.0% 0036609 00366092 2/2   S ferredoxins                           
   5::87   1.9e-10 31.9% 0052779 00527791 1/2   S ferredoxins                           
  58::115  4.7e-10 41.8% 0046749 00467492 2/2   S ferredoxins                           
   6::86   4.8e-10 37.9% 0035614 00356141 1/2   S ferredoxins                           
  58::115  7.5e-10 41.8% 0046170 00461702 2/2   S ferredoxins                           
  58::115    1e-09 41.8% 0052658 00526582 2/2   S ferredoxins                           
  88::152  2.8e-09 34.4% 0043631 00436312 2/2   S ferredoxins                           
  87::153  4.8e-09 29.7% 0046879 00468792 2/2   S ferredoxins                           
  88::152  1.7e-08 37.5% 0039453 00394532 2/2   S ferredoxins                           
   4::86   3.1e-08 34.8% 0039453 00394531 1/2   S ferredoxins                           
   6::86   6.4e-08 37.9% 0049159 00491591 1/2   S ferredoxins                           
   1::81   1.7e-07 24.3% 0037513 00375131 1/2   S ferredoxins                           
   3::86   6.5e-07 28.6% 0046879 00468791 1/2   S ferredoxins                           
  88::152  3.6e-06 42.9% 0037513 00375132 2/2   S ferredoxins                           
   3::87   3.9e-06 25.8% 0043631 00436311 1/2   S ferredoxins                           
  88::151  8.2e-06 32.7% 0044815 00448152 2/2   S ferredoxins                           
  90::147  1.2e-05 40.8% 0046874 00468742 2/2   S ferredoxins                           
   6::85   0.00031 26.8% 0046874 00468741 1/2   S ferredoxins                           
   4::85    0.0012 25.4% 0044815 00448151 1/2   S ferredoxins                           
   5::23     0.087 42.1% 0039666 00396661 1/2   S ferredoxins                           
   6::23       0.4 44.4% 0035446 00354461 1/2   S ferredoxins                           
   6::23      0.62 44.4% 0053368 00533681 1/2   S ferredoxins                           
   6::23      0.75 50.0% 0047149 00471491 1/2   S ferredoxins                           
   1::23      0.88 34.8% 0047184 00471841 1/2   S ferredoxins                           
   2::23         2 36.4% 0045037 00450371 1/2   S ferredoxins                           
   6::23       2.2 38.9% 0036609 00366091 1/2   S ferredoxins                           
   6::23       3.1 38.9% 0046749 00467491 1/2   S ferredoxins                           
   6::23       3.9 38.9% 0046170 00461701 1/2   S ferredoxins                           
   6::23       4.3 38.9% 0052658 00526581 1/2   S ferredoxins                           
   1::219


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MANYAIVTDLNRCTGCLACTVACKAINGVDVGSFWIKTLRVGPHPIEGGSGTFPDVEMYFLPVQCQHCEN
00425621   1/1  MkvkaqygmvidldkCigCgaCvvaCkeennlpvgveylwfnnvetkPglgyprgaedleklkggwvlkf
00440151   1/1  marygividlskCigcgaCevaCkdenllpvgltlalldellrpllpvkflekgvvppllalylpvlCih
00383611   1/1  --qkgilidldkCigCgaCvvaCkeenilpalllarrvlellpaallplaallvlllelgvvgkvlalfl
00402101   1/1  --hlclegicggcgfcilacptgalddggsvkilidlskCigCgaCvaaCptelllpflpgklrgkillt
00384661   1/1  laaglgavididkclgcgacvvacpvelnlpvgkllgrlyvprievpeldpeerlkdfdevlllglgeee
00384701   1/1  --rlgllvdllkctgCgaCgvacpveallp....ggllpacgpyveagalgetiv...lflpllcllc..
00533682   2/2  ---------------------------------------------------------ivvdpdkCigCgl
00529281   1/1  -----fvillsvcigctacevacpvgailkd..........................glividaelcigc
00396662   2/2  --------------------------------------------------------vavidedkCigCgh
00527741   1/1  --lvlelllanhcldcgvCekagecel...................qdlavllgvlksrfvpekcrhcg.
00391421   1/1  --rmrvvvdedkCigCgaCvaaC......................................pvgaivldd
00354462   2/2  ---------------------------------------------------------avvdldkCigCgl
00450372   2/2  ----------------------------------------------------llllllalllllcgccgd
00458591   1/1  llplekldilrpvividldkCigCgaCvavCpvgaitlvllg...........................p
00471842   2/2  ---------------------------------------------------------------lllllll
00483461   1/1  --drrklidldkCigCgaCvaaCPvyaitgde.............................flgprglic
00471492   2/2  ---------------------------------------------------------ividldkCigCed
00520341   1/1  ---pkilidldkCigCgaCvaaCPtgaitgd............................flgprcllc..
00477911   1/1  perfrplidldkCigCgaCvaaCPtgaitpd..............................flgprglic
00527792   2/2  ----------------------------------------------------------------------
00356142   2/2  ----------------------------------------------------------------------
00491592   2/2  ----------------------------------------------------------------------
00366092   2/2  ---------------------------------------------------------llvdlelCigcgl
00527791   1/2  ----cPlgalvlldngrgdislpivvidedkCigCgaCvaaCPtgaitgdealdprgri.........ie
00467492   2/2  ---------------------------------------------------------llidldlCigcgl
00356141   1/2  -----llidldkCigCgaCvlaCpvgaillvee.......................llvidpdlCigclg
00461702   2/2  ---------------------------------------------------------llidldlCigcgl
00526582   2/2  ---------------------------------------------------------llidldlCigcgl
00436312   2/2  ----------------------------------------------------------------------
00468792   2/2  ----------------------------------------------------------------------
00394532   2/2  ----------------------------------------------------------------------
00394531   1/2  ---llvvidldkCigCglCvraCp......vgaivlvell.........glllllllvvidpdlCigC..
00491591   1/2  -----vlidldkCigCgaCvlaC.......................pvgaillgdellvidpdkCigCgd
00375131   1/2  lgaklkldlllglvvidedkCigCgrCvraCpvgaitlvlllllr.........gllllvglklvvvidl
00468791   1/2  --lglvvvdedkCigcglCvlacpdaivldddglvvvlle...................vdldlcigcga
00375132   2/2  ----------------------------------------------------------------------
00436311   1/2  --lglvvvdedkCigcglCvlacPvgaill.................ddggvavkltlvvdedlcigc..
00448152   2/2  ----------------------------------------------------------------------
00468742   2/2  ----------------------------------------------------------------------
00468741   1/2  -----vvvdedkCigcglCvlvCpvgailld......................dgllvvlvidldlcigc
00448151   1/2  ---lkvvvdedkCigcglCvlvCpvgailld.....................dgllllvvdldlcigc..
00396661   1/2  ----vavidedkCigCghcedaa-----------------------------------------------
00354461   1/2  -----avvdldkCigCglapCva-----------------------------------------------
00533681   1/2  -----ivvdpdkCigCglapCve-----------------------------------------------
00471491   1/2  -----ividldkCigCedglCve-----------------------------------------------
00471841   1/2  lslglvvidedkCigCglCvaaC-----------------------------------------------
00450371   1/2  -ergivvidedkCigCglCvaaC-----------------------------------------------
00366091   1/2  -----llvdlelCigcglCvevC-----------------------------------------------
00467491   1/2  -----llidldlCigcglCvkvC-----------------------------------------------
00461701   1/2  -----llidldlCigcglCvkvC-----------------------------------------------
00526581   1/2  -----llidldlCigcglCvkvC-----------------------------------------------


                         -         -         *         -         -         -         -:140
query           PECVKVCPTEASHIRDDGTVQIDKSKCIGCQFCAMACPYGVRYLNQEERVVEKCTLCEQRISQGELPQCV
00425621   1/1  dgellpalggilagllnicpnphlpdiddyyepftydylvlfgapvgcklcptacpvslitgkplfkiea
00440151   1/1  CedppCv.vCPtgAiykdedgivlidpdkCigCgyCvlaCPygairlneetgvaekCtlCldrlatillg
00383611   1/1  pvlCvhCgdpaCvavCPtgaillvlkdeedgivlidpdlskCigCgyCvaaCPygaivinpetgvaekCt
00402101   1/1  laglgaaigrvdlsdi..gtypkpgpviepdrCihCgdppCvkaCPtgAiskdpedgivvidedrCigCg
00384661   1/1  alrealrCihCgdppCvkvCPtgaiipeliglvyegdigealelllstnplplvdgrvCigCglCeeaCP
00384701   1/1  gpcvlvCptgaiagicelaellglallplgllgllgdlslgvvvidedkCigCglCvraCPvgaislvel
00533682   2/2  apCvevCpvgaiyl.edgivvidpdkCigCglCvavCPvgaitlepelglaekcllclnrelcggcpacv
00529281   1/1  gpCvrvCPagaieivedggglllrvvinaenCigCgtCviaCPtgaislvppeggvgp------------
00396662   2/2  cedaaCvevCPvgaitldedgllivvidpdkCigCglCvevCPtgAidivplleeareellelylelvea
00527741   1/1  .pcvlvcPvgaivlvddsgglivideekCigCgrCvraCpevaitlvlglagrgldtrigtvidaskCvl
00391421   1/1  glcvrvcptg......dgivvidpdlcigcgaCvaaCPvgaitleeetglalkcdlc-------------
00354462   2/2  apCvavCpvgaill.edgivvidpdlCigcglCvevCPvgaillellllllekcllcgacvlacp-----
00450372   2/2  cvcayacptgailgrergivvidedkCigCglCvaaCPvgaisldglglerlvlllklvidlekCigC..
00458591   1/1  racilc..pacvkvcptgallklegggrvvidldkCigCglCvevCPvgaiilel.ilelrkcilc....
00471842   2/2  alcplvcplgalpllslglvvidedkCigCglCvaaCpvgaivlelekglvvidlekCigC.........
00483461   1/1  alrlladprdaltkerledliveidldrCigCgaCvevCPvgiilvdliaelrrllvkr-----------
00471492   2/2  glCvevCpvgaivl.edglvvidpdlCigCglCvlvCPvgaillkllllllllllldllldll-------
00520341   1/1  aacllacprgaitleerledglvvidldrCigCgaCvevCPvgai-------------------------
00477911   1/1  alcllacprdaltkerledllvvidldrCigCgaCvevCPvgailvdlirelrrelv-------------
00527792   2/2  ------------------cPlgalvlldngrgdislpivvidedkCigCgaCvaaCPtgaitgdealdpr
00356142   2/2  ---------------------llidldkCigCgaCvlaCpvgaillvee.llvidpdlCigclgkgeega
00491592   2/2  -------------------vlidldkCigCgaCvlaCpvgaillgdellvidpdkCigCgdr...glepa
00366092   2/2  ..CvevCpvgaill..dglvlidldlcigcglCvlvCPvgailled------------------------
00527791   1/2  ldgkvplrfridpdkCi-----------------------------------------------------
00467492   2/2  ..CvkvCpvgaill.ldglvvidldlCigcglCvlvCPvgaille-------------------------
00356141   1/2  kgeegaCvevCPtgAi------------------------------------------------------
00461702   2/2  ..CvkvCpvgaill.ldglvvidldlCigcglCvlvCPvgaille-------------------------
00526582   2/2  ..CvkvCpvgaill.ldglvvidldlCigcglCvlvCPvgaille-------------------------
00436312   2/2  -----------------lglvvvdedkCigcglCvlacPvgailldd.ggvavkltlvvdedlcigcgaC
00468792   2/2  ----------------lglvvvdedkCigcglCvlacp.daivldddglvvvllevdldlcig..cgaCv
00394532   2/2  -----------------llvvidldkCigCglCvraCpvgaivlvellglllllllvvidpdlCigC...
00394531   1/2  gaCvevCPtgaitlvd------------------------------------------------------
00491591   1/2  rglepaCvevCPvgai------------------------------------------------------
00375131   1/2  ekCigC..gaC-----------------------------------------------------------
00468791   1/2  ..CvevCPvgAislee------------------------------------------------------
00375132   2/2  -----------------lgaklkldlllglvvidedkCigCgrCvraCpvgaitlvlllllrgllllvgl
00436311   1/2  gaCvevCPvgAitlvee-----------------------------------------------------
00448152   2/2  -----------------lkvvvdedkCigcglCvlvCpvgaillddgllllvvdldlcigc.........
00468742   2/2  -------------------vvvdedkCigcglCvlvCpvgaillddgllvvlvidldlcigc........
00468741   1/2  ..glCvevCPvgAis-------------------------------------------------------
00448151   1/2  glCvevCPvgAisle-------------------------------------------------------
00396661   1/2  ----------------------------------------------------------------------
00354461   1/2  ----------------------------------------------------------------------
00533681   1/2  ----------------------------------------------------------------------
00471491   1/2  ----------------------------------------------------------------------
00471841   1/2  ----------------------------------------------------------------------
00450371   1/2  ----------------------------------------------------------------------
00366091   1/2  ----------------------------------------------------------------------
00467491   1/2  ----------------------------------------------------------------------
00461701   1/2  ----------------------------------------------------------------------
00526581   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AQCGARARFFGDLDQGVDNFEGPAHPDSPGCQYEEMTQTRVKLKDYVEPYTENDIHHLADVGNEPKLMYL
00425621   1/1  gpnwdddlggslvl--------------------------------------------------------
00440151   1/1  gkaPaCveaCptgallfgdledllaeakklle.lllvllpelgtgpevly--------------------
00383611   1/1  lCgdrleegllPaCv-------------------------------------------------------
00402101   1/1  aCvrvCPvgaitid--------------------------------------------------------
00384661   1/1  vgaii-----------------------------------------------------------------
00384701   1/1  dpegkvvidpdkCtgC....--------------------------------------------------
00533682   2/2  eacptgaltfgllddllklvilll----------------------------------------------
00529281   1/1  ----------------------------------------------------------------------
00396662   2/2  lllllelgggllkgllcv----------------------------------------------------
00527741   1/1  C.........ga----------------------------------------------------------
00391421   1/1  ----------------------------------------------------------------------
00354462   2/2  ----------------------------------------------------------------------
00450372   2/2  .......gaCvev---------------------------------------------------------
00458591   1/1  .....ga---------------------------------------------------------------
00471842   2/2  gaCvevCptgait---------------------------------------------------------
00483461   1/1  ----------------------------------------------------------------------
00471492   2/2  ----------------------------------------------------------------------
00520341   1/1  ----------------------------------------------------------------------
00477911   1/1  ----------------------------------------------------------------------
00527792   2/2  griieldgkvplrfr-------------------------------------------------------
00356142   2/2  CvevCPtgAivl----------------------------------------------------------
00491592   2/2  CvevCPvgaillg---------------------------------------------------------
00366092   2/2  ----------------------------------------------------------------------
00527791   1/2  ----------------------------------------------------------------------
00467492   2/2  ----------------------------------------------------------------------
00356141   1/2  ----------------------------------------------------------------------
00461702   2/2  ----------------------------------------------------------------------
00526582   2/2  ----------------------------------------------------------------------
00436312   2/2  vevCPvgAitlv----------------------------------------------------------
00468792   2/2  evCPvgAisleee---------------------------------------------------------
00394532   2/2  ......gaCvev----------------------------------------------------------
00394531   1/2  ----------------------------------------------------------------------
00491591   1/2  ----------------------------------------------------------------------
00375131   1/2  ----------------------------------------------------------------------
00468791   1/2  ----------------------------------------------------------------------
00375132   2/2  klvvvidlekCi----------------------------------------------------------
00436311   1/2  ----------------------------------------------------------------------
00448152   2/2  glCvevCPvgA-----------------------------------------------------------
00468742   2/2  .glCvev---------------------------------------------------------------
00468741   1/2  ----------------------------------------------------------------------
00448151   1/2  ----------------------------------------------------------------------
00396661   1/2  ----------------------------------------------------------------------
00354461   1/2  ----------------------------------------------------------------------
00533681   1/2  ----------------------------------------------------------------------
00471491   1/2  ----------------------------------------------------------------------
00471841   1/2  ----------------------------------------------------------------------
00450371   1/2  ----------------------------------------------------------------------
00366091   1/2  ----------------------------------------------------------------------
00467491   1/2  ----------------------------------------------------------------------
00461701   1/2  ----------------------------------------------------------------------
00526581   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           MREGRKWRE-------------------------------------------------------------
00425621   1/1  ----------------------------------------------------------------------
00440151   1/1  ----------------------------------------------------------------------
00383611   1/1  ----------------------------------------------------------------------
00402101   1/1  ----------------------------------------------------------------------
00384661   1/1  ----------------------------------------------------------------------
00384701   1/1  ----------------------------------------------------------------------
00533682   2/2  ----------------------------------------------------------------------
00529281   1/1  ----------------------------------------------------------------------
00396662   2/2  ----------------------------------------------------------------------
00527741   1/1  ----------------------------------------------------------------------
00391421   1/1  ----------------------------------------------------------------------
00354462   2/2  ----------------------------------------------------------------------
00450372   2/2  ----------------------------------------------------------------------
00458591   1/1  ----------------------------------------------------------------------
00471842   2/2  ----------------------------------------------------------------------
00483461   1/1  ----------------------------------------------------------------------
00471492   2/2  ----------------------------------------------------------------------
00520341   1/1  ----------------------------------------------------------------------
00477911   1/1  ----------------------------------------------------------------------
00527792   2/2  ----------------------------------------------------------------------
00356142   2/2  ----------------------------------------------------------------------
00491592   2/2  ----------------------------------------------------------------------
00366092   2/2  ----------------------------------------------------------------------
00527791   1/2  ----------------------------------------------------------------------
00467492   2/2  ----------------------------------------------------------------------
00356141   1/2  ----------------------------------------------------------------------
00461702   2/2  ----------------------------------------------------------------------
00526582   2/2  ----------------------------------------------------------------------
00436312   2/2  ----------------------------------------------------------------------
00468792   2/2  ----------------------------------------------------------------------
00394532   2/2  ----------------------------------------------------------------------
00394531   1/2  ----------------------------------------------------------------------
00491591   1/2  ----------------------------------------------------------------------
00375131   1/2  ----------------------------------------------------------------------
00468791   1/2  ----------------------------------------------------------------------
00375132   2/2  ----------------------------------------------------------------------
00436311   1/2  ----------------------------------------------------------------------
00448152   2/2  ----------------------------------------------------------------------
00468742   2/2  ----------------------------------------------------------------------
00468741   1/2  ----------------------------------------------------------------------
00448151   1/2  ----------------------------------------------------------------------
00396661   1/2  ----------------------------------------------------------------------
00354461   1/2  ----------------------------------------------------------------------
00533681   1/2  ----------------------------------------------------------------------
00471491   1/2  ----------------------------------------------------------------------
00471841   1/2  ----------------------------------------------------------------------
00450371   1/2  ----------------------------------------------------------------------
00366091   1/2  ----------------------------------------------------------------------
00467491   1/2  ----------------------------------------------------------------------
00461701   1/2  ----------------------------------------------------------------------
00526581   1/2  ----------------------------------------------------------------------