[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30141.1


[Show Plain Result]

## Summary of Sequence Search
   1::248
  47::229  PF01180 0.0% 25.6983240223464  Dihydroorotate dehydrogenase 
 182::242  PF00977 0.0% 30.3571428571429  Histidine biosynthesis protein 
   1::248


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQNQDLKRIIISPPFGKYLKFKETSNVYGSFTVNRRWGLIKQAIKTIRKIDKNAWRNKIGLRNPGLANTN
PF01180         ----------------------------------------------frlpedrsvlNsiGlnneGldavl
PF00977         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           PPKRAQDIISLAALDMSDWHSFAETLKLPKFAQHRNIEINIGCPNASIVDFPAELAPLFEDRNISIKMPP
PF01180         eellkrrkeqeeevgiilskakktenavedyvevvrkig..rlad..ilelNvSsPntpglrdlqekeel
PF00977         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TVDHNAKIREYLAVGITTFHLCNTIPTAKGGISGYPLHKYSLPAIKKARQEFGDSITIIGGGGIYTLDDA
PF01180         kaillkvvkevskvpvlvklaPdltdeekkdiadvllelkldgiivtNttvqrnridlkseknikanktG
PF00977         -----------------------------------------ldlveeiaeevf..iplqvGgGIrsledv


                         -         -         -         +         -         -         -:280
query           KKYIEAGADHLSLSSIMFNPIRGKKLVKEIVKFWLDDF--------------------------------
PF01180         GlsGkalkdialkvirely---------------------------------------------------
PF00977         eelleagadkviigta...avknpelikelae--------------------------------------