[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30153.1


[Show Plain Result]

## Summary of Sequence Search
   1::118
  35::104  PF04355 0.0% 29.4117647058824  SmpA / OmlA family 
   1::118


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFRPITKNLCLLIAAFSLSACGIIQPYTAPVPQGKEIKDKKLFEIKPNMTKSEVTYILGSPDIIDTFNPN
PF04355         ----------------------------------nvvtqeavdqlkpGmtkeqVryllGsPsltdtfdpn


                         -         -         *         -         -         -         -:140
query           QYVYINTYKRNMQDTQFSESKLILTFNNQDRLIGISGNYAPPTKDPVF----------------------
PF04355         rwdYvynfrrgreave..qqvlavyFdddglvrn------------------------------------