[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30267.1


[Show Plain Result]

## Summary of Sequence Search
   1::209
   8::197  PF02223 0.0% 41.6216216216216  Thymidylate kinase 
   1::209


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIHSDSELLM
PF02223         -------iEGlDGaGKttqaellkeklkeqgikvvltrepggteiGelirelllkeeeleelt....eal


                         -         -         *         -         -         -         -:140
query           IYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDP
PF02223         lfaadriehleekikpalkqgktvivdRylfSslaYqgakegvdldlvlslnedvlld.kPdltflldvd


                         +         -         -         -         -         *         -:210
query           ILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNAIEIDAAKSIQEVEKQIYLILDKHFNFQN-
PF02223         pevalkRlrkrgeldeeeeeqldflrkvrekylelakekeriliidasksieevhee-------------