[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30290.1


[Show Plain Result]

## Summary of Sequence Search
   1::1417
  13::340  PF04997 0.0% 40  RNA polymerase Rpb1, domain 1 
 763::1309 PF04998 0.0% 34.6715328467153  RNA polymerase Rpb1, domain 5 
 342::484  PF00623 0.0% 46.8531468531469  RNA polymerase Rpb1, domain 2 
 487::642  PF04983 0.0% 32.5925925925926  RNA polymerase Rpb1, domain 3 
 671::748  PF05000 0.0% 28.5714285714286  RNA polymerase Rpb1, domain 4 
   1::1417


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNNGILHQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLC
PF04997         ------------kkikevqfgiaspeeirkwSvvevtkpetinekslkpeegGllderigt.........
PF04998         ----------------------------------------------------------------------
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GKYKRLKHRGVVCERCGVEVEQAKVRRERMGHIDLVCPVVHIWYLKSLPSRIGLFLDMPLKNVEKVLYFE
PF04997         ikkks......iCetckeevte...crghfGhieLakPvfhigffkkvlsilkcvcvlcsslllseeekk
PF04998         ----------------------------------------------------------------------
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SYIVTDPGMTPLEKKQLLTDEEYAEALENYGYEFEASMGAEAIRDLLADTDIESEIELLQAECEESKSTA
PF04997         feekvvkkkkgkkkkkklkiinelckkksicekskeenenvkdelekleaaegcekkqpkiskegaeale
PF04998         ----------------------------------------------------------------------
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KKEKAIKRLRLLETFQASGNKPEWMVMTVLPVLPPDLRPLVPIEGGRFATSDLNDLYRRVINRNNRLKKL
PF04997         ellkkseeeeelkeklrklnaekvlqilkkiskedveilgfnnsgskPewliltvlPVpPpeiRPsvqld
PF04998         ----------------------------------------------------------------------
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LDLNAPDIIVRNEKRMLQEAVDALLDNGRRGRAVTGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGR
PF04997         gkrtaedDlteklreIikrNnrLkkleeegapehiireekrlLQehvatlfdneskgkpv----------
PF04998         ----------------------------------------------------------------------
PF00623         -------------------------------------------------------------GkrvdfsaR
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SVITVGPSLRLHECGLPKKMALELFKPFVYSKLRLGGHATTIKQAKRMVELEEAVVWDILETVINEHPVL
PF04997         ----------------------------------------------------------------------
PF04998         ----------------------------------------------------------------------
PF00623         svitpdpnlkldevgvPkelakkLtvpeivtklnikklkklvengknkypgakyieeekgakkklekkke
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LNRAPTLHRLGIQAFEPRLIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLTVESQLEARVLMMSTNNILS
PF04997         ----------------------------------------------------------------------
PF04998         ----------------------------------------------------------------------
PF00623         klakeleagkkvlrhvkkgdvvllNRqPtLhrlsimahrvrvlegktlrlnllvckayNaDFDG------
PF04983         ------------------------------------------------------------------nils
PF05000         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           PASGQPIITPTQDIVLGLYYITREKEGARGEGKLFSSYEDVSRAYNSGTIDIHAKIKLRIDRQVFDTKGN
PF04997         ----------------------------------------------------------------------
PF04998         ----------------------------------------------------------------------
PF00623         ----------------------------------------------------------------------
PF04983         pqsgkPvigivQDsllGvyllTked........vfidreeaqqllykgvgsdkktvtlrpailvp.ke..
PF05000         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           TYNEKGVVNTTVGRALLLNILPEGLSFSLLNKVLVKKEISKIINQAFRVLGGKATVVLADKLMYAGFKYS
PF04997         ----------------------------------------------------------------------
PF04998         ----------------------------------------------------------------------
PF00623         ----------------------------------------------------------------------
PF04983         ..........lwtgkqtfsrilpneinyerkpnlekgkvlikngelikGvidkkvvgkksqgslihvlak
PF05000         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           TLSGVSVGVDDMTIPDNKEAKIEEAEKEIKQITEQYQSSLITENERYNNIINIWSKTSDEVGASMMDAIS
PF04997         ----------------------------------------------------------------------
PF04998         ----------------------------------------------------------------------
PF00623         ----------------------------------------------------------------------
PF04983         eygiketvrfld----------------------------------------------------------
PF05000         ----------------------------------------ieeaerygkledlpgksleelfeakinkil


                         -         -         -         -         +         -         -:770
query           KDTVSINGEKKEIESFNSVYMMAKSGARGSYNQMRQLAGMRGLMAKPDGTMIETAITANFREGLSVLQYF
PF04997         ----------------------------------------------------------------------
PF04998         --------------------------------------------------------------GLtpqeff
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         nkardkagkiakksla.anNsiliMvdsGaKGsiinisqiagclGqqn----------------------


                         -         -         *         -         -         -         -:840
query           TSTHGARKGLADTALKTANAGYLTRRLVDVAQDLVVIEEDCGTDDGLMFSAIVEDGEVKVPLVERALGRT
PF04997         ----------------------------------------------------------------------
PF04998         fhtmggReGLiDTAvKTaetGYlqRrLvkaledvvvkyddtvrnsggeivqflygedg............
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           LAADVVTEKGVVLLEAGTLLDENLVELLDDNGIDMIKVRSPITCKTRRGLCAKCYGRDLARERQVNVGES
PF04997         ----------------------------------------------------------------------
PF04998         ...............................................................lvepGea
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           VGVIAAQSIGEPGTQLTMRTFHTGGAASLGITVSDIKVKTAGKIKFKNIRTVTNKEGQEIVISRAGEIIV
PF04997         ----------------------------------------------------------------------
PF04998         vGiiAAQSiGEPgTQltlnTFHfaGvasknvtlgvprlkeilnvaknnkkpvltvllekkaekkkakakk
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           SDTMGRVREQHKIPMGAVVPLASGKAVEIGDVIATWDPHAQPLITDVAGKVVLEDVIDGITSKHTYDDLT
PF04997         ----------------------------------------------------------------------
PF04998         vkeeeel...............................................................
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           GQQTIEITSISQRTTSKNLKPVVKIVDEKGAKLKSIPLAVGAVLNVADDSILEVGDIVAKIPLEGSKNKD
PF04997         ----------------------------------------------------------------------
PF04998         ......................................................................
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           ITGGLPRVAELFEARRPKDAAILSPCDGMVRLGNRDTKEKQRIEIIDKNGHIVEEILLPKSRHLVVFDGE
PF04997         ----------------------------------------------------------------------
PF04998         .................................................................vkege
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1260
query           QVSRGDVLADGPTDPHDLLKYKGLEEFADYILIEAQSVYRMQGVVINDKHIETIVRQMLRKAVILDEGDS
PF04997         ----------------------------------------------------------------------
PF04998         kvkagekltdgrvdpeeklekkekelllktegtelqevyklqgvidndktvsndikeilkvlgIeaares
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:1330
query           KFVKDESIELVRILEENDKLRKQGKKEVEYELVLMGITRSSLSTESFLSAASFQETTRVLTEASINSQID
PF04997         ----------------------------------------------------------------------
PF04998         ilkeieevfkeegievnrrhlalladlmtakgvllgitraglnkekesf---------------------
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:1400
query           NLRGLKENVLIGRLIPTGTGLAVRKESAKIEKMREELGVEDNMVFTDLSSFNPEEISFDSIQSQKEDKDI
PF04997         ----------------------------------------------------------------------
PF04998         ----------------------------------------------------------------------
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:1470
query           NEDIEESLRNALESLDF-----------------------------------------------------
PF04997         ----------------------------------------------------------------------
PF04998         ----------------------------------------------------------------------
PF00623         ----------------------------------------------------------------------
PF04983         ----------------------------------------------------------------------
PF05000         ----------------------------------------------------------------------