[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30317.1


[Show Plain Result]

## Summary of Sequence Search
   1::484
  72::113  PF02386 0.0% 26.1904761904762  Cation transport protein 
 153::482  PF02386 0.0% 21.9135802469136  Cation transport protein 
   1::484


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MMLSQKPKIIGIFLMFLSLTMLSPLLVDYIYDEDNAYPFVLSFTVTFLCGFLLWFISRKSNKKLSNRDGF
PF02386         ----------------------------------------------------------------------
PF02386         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LIVTLVWIFVTVFGAIPYMSFPGLNLSFTNAVFESVSGFTTTGGTVIEGLDKLPHSILFYRQQTEFFGGM
PF02386         -llvflllfiivilegllLslleedpffldilfevvSAfGtVG---------------------------
PF02386         -llvflllfiivilegllLslleedpffldilfevvSAfGtVG---------------------------


                         +         -         -         -         -         *         -:210
query           GIIVLSVAILPLLGVGGMQLYKAEVSGQWKDDKIAPKISSTAKALWMVYLLLTFLCFISYLLVGVEPFDA
PF02386         ------------lggseyrslkrlikilvvylfiieiiafvlllililtvklyseavr..kkggsalwda
PF02386         ------------lggseyrslkrlikilvvylfiieiiafvlllililtvklyseavr..kkggsalwda


                         -         -         -         +         -         -         -:280
query           ICYTFSTVSTGGFAPSDASMTDKPLGMLIVCAIFLFLGATSFKAHYIALSKFKISHYFRNIEFKAYFYFL
PF02386         lfhslSafnnaGfsltseSlvsfnkavviqlvlifliilGgigFpvllrlliwikkkikkkelslflkdh
PF02386         lfhslSafnnaGfsltseSlvsfnkavviqlvlifliilGgigFpvllrlliwikkkikkkelslflkdh


                         -         *         -         -         -         -         +:350
query           FFTSFIVCITIITHTNDLSNIFSIVTNSIFQVISISSSAGFVSDNNYYLWPSFLPIMLMFIAIIGGCGGS
PF02386         prrtfl.llllsfvtllllevlavlnvlkslslgsrvlnaffqvvs.trtaGfsvv.dlsqlspaikvll
PF02386         prrtfl.llllsfvtllllevlavlnvlkslslgsrvlnaffqvvs.trtaGfsvv.dlsqlspaikvll


                         -         -         -         -         *         -         -:420
query           TAGGLKMIRAILFKEKAILEARRVIHPQGVFTVKLGDIHISEQALNRVSGFISVYIIIFAGGWLALLGCG
PF02386         mllMfiGgspgstaggiktvtfavilkal.keikraelpgakevkkfkgrslreqlvedallvflllfii
PF02386         mllMfiGgspgstaggiktvtfavilkal.keikraelpgakevkkfkgrslreqlvedallvflllfii


                         -         -         +         -         -         -         -:490
query           LDIPTAFSTIATTLSNVGPGLGDIGSNFKNLPKEALWICNFAMIAGRLEIFTILVLFMPDFWRK------
PF02386         vilegllLslleedpffldilfevvSAfGtVGLSlGittknlslsptlgklvlillmiiGRl--------
PF02386         vilegllLslleedpffldilfevvSAfGtVGLSlGittknlslsptlgklvlillmiiGRl--------