[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30340.1


[Show Plain Result]

## Summary of Sequence Search
   1::274
   6::168  PF00106 0.0% 29.9363057324841  short chain dehydrogenase 
   7::167  PF08659 0.0% 22.5806451612903  KR domain 
   8::138  PF01370 0.0% 25  NAD dependent epimerase/dehydratase family 
   6::60   PF08643 0.0% 15.0943396226415  Fungal family of unknown function (DUF1776) 
  87::267  PF08643 0.0% 15.5555555555556  Fungal family of unknown function (DUF1776) 
  17::90   PF00107 0.0% 28.9855072463768  Zinc-binding dehydrogenase 
   1::274


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVNNSKTILITGCSHGGIGYATAVHLKNLGHRVFASARQQKDVEALSQEGFETYLIDVTNYEYIDNALAD
PF00106         -----gtvliTGGl.gglGlalArwLveegarhlvlvsrredapgaaeliaelealgaevtvvacDvadr
PF08659         ------tyLvtGG.lgglGlelarwLaergarhlvllsrsaapdeeaeallaelealgaevtvvaaDvad
PF01370         -------ilVtGg.tGfiGsalveallekgyevvdnlirrtrseelaterlrvelvegdltdkdalerlf
PF08643         -----evvvvaGsptePltrsialDLerRGFiVfvvvesaeeeklvesea.red.Irpls----------
PF08643         -----evvvvaGsptePltrsialDLerRGFiVfvvvesaeeeklvesea.red.Irpls----------
PF00107         ----------------GvGlaavqlAkalGarviavdsseeklelakelG.adhvinskded....fvka


                         -         -         *         -         -         -         -:140
query           ILNKTGGSLDVIFNNAGYGQAGALEDIDTKFLKQQFETNVFGLHNLTYKALKIMRKQGYGKIIQHSSVLG
PF00106         dalaallaeir.kelgpldgvvhaagvlddglleeltperlervlapkvtgawllheltld....adlga
PF08659         rdavealleeveaee.pplrGvvhaAgvlrdallaemtaedlaavlapKvtGawnLh....elladepld
PF01370         aee......qpdaVihlaaesg....vdassedpadfienn....vvgtlnlleaarkagvkrlvfls--
PF08643         ----------------sy.ptgpiatiplssladelntrllnpiltlqallplltsrskqkskiivltps
PF08643         ----------------sy.ptgpiatiplssladelntrllnpiltlqallplltsrskqkskiivltps
PF00107         ireltggkgvdvviecvgag--------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LVAMKYRGAYNASKYAIEGLTDTMRLELRDSNIFITSLNTGPITSKFRENSIKTITNVNYDSSVHKQQYE
PF00106         fvlfSSvagvlgspgqaaYaaakaalda------------------------------------------
PF08659         ffvlfSSiagvlgsagqanyaaanafl-------------------------------------------
PF01370         ----------------------------------------------------------------------
PF08643         iisslnlpfhapEalvssalsalfeiLkrelrplsidvtqikLGnldlsnfgsqsnskiasvkgsevlsW
PF08643         iisslnlpfhapEalvssalsalfeiLkrelrplsidvtqikLGnldlsnfgsqsnskiasvkgsevlsW
PF00107         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KILARQHKKVPFNEPAISVAKVVEKIINCDKPKPRYYITKATWIMTSLKRILPTNILDNFLNRY------
PF00106         ----------------------------------------------------------------------
PF08659         ----------------------------------------------------------------------
PF01370         ----------------------------------------------------------------------
PF08643         seearalygpnyksiqskaigaksgglrGsslreLhnalfdlleekskksvvyvGkg-------------
PF08643         seearalygpnyksiqskaigaksgglrGsslreLhnalfdlleekskksvvyvGkg-------------
PF00107         ----------------------------------------------------------------------