[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30379.1


[Show Plain Result]

## Summary of Sequence Search
   1::167
   8::163  PF03938 0.0% 23.8709677419355  Outer membrane protein (OmpH-like) 
   1::167


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKIALSICVLVSAFTAAYADTKIAVVNPVEIFNDSDLGSVSVKKLENDLKPDATKLKQEQDNIMQQMKT
PF03938         -------lal.lsagsaaaaqkpkvgvvdvqkvlkaspkykelqaklqeeakekqqelqakkkelqkeqk


                         -         -         *         -         -         -         -:140
query           LQDNSATMTKSELDKKQQQIQQEQQNFAEKARILQQKEYTAKDKLSKKFQASFDKAVQTIAKQKNYNVVL
PF03938         nlqseraqlsaeaekakeeelqakeqelqayaqqlqaelqaeqqevlqklidkiadaikkvakekgltlV


                         +         -         -         -         -         *         -:210
query           TTQALAYVNNVDDISSQVVELMNKDSE-------------------------------------------
PF03938         lttskvlyadeavDiTdaViael-----------------------------------------------