[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30394.1


[Show Plain Result]

## Summary of Sequence Search
   1::230
  37::124  PF00636 0.0% 47.7272727272727  RNase3 domain 
 154::221  PF00035 0.0% 37.8787878787879  Double-stranded RNA binding motif 
   1::230


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVPEYSRFYNILGYNFKDYTLLIRALTHRSKTKKNYERLEFLGDSVLSFVIAEVLYKQFTDLAEGKLSQL
PF00636         ------------------------------------erLeflGdsilklaittylfetypdahegrlskl
PF00035         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           RSKLVKGTTLAQLASSLKMDEYIILGASEQGGHKREKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPI
PF00636         rsklvsnenlarlakklgLpsflrvskfdpsvnwdksstdkedsdenkdiadkv----------------
PF00035         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ISSINLDTIKVKDSKSKLQEILLQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKAE
PF00636         ----------------------------------------------------------------------
PF00035         -------------pkskLqe.lcqkkgkpppyeyvseegpshslpkFtvtvkvng.kkigtgvgssKKeA


                         -         -         -         +         -         -         -:280
query           QKTAEKMIEMLSQQGLHEKK--------------------------------------------------
PF00636         ----------------------------------------------------------------------
PF00035         eqlAAekALqk-----------------------------------------------------------