[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30441.1


[Show Plain Result]

## Summary of Sequence Search
   1::334
   5::289  PF00579 0.0% 37.037037037037  tRNA synthetases class I (W and Y) 
   4::25   PF01921 0.0% 31.8181818181818  tRNA synthetases class I (K) 
 149::241  PF01921 0.0% 21.4285714285714  tRNA synthetases class I (K) 
   1::334


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSQKIILTGVTPSGTPHLGNYIGAIKPAIEMIKNDQYKCMYFIADQHSLIKLWDKKLRQQYIYEIAASWL
PF00579         ----rvysGidPTgklHlG.ylvplkklvqlqk.agyevffliaDltAligdpskaeerklrkreeelen
PF01921         ---vvvesGispSGliHiGnlrevl---------------------------------------------
PF01921         ---vvvesGispSGliHiGnlrevl---------------------------------------------


                         -         -         *         -         -         -         -:140
query           ALGLDPDKAYFYRQSDIPEIMELTWIISTTTAKGLLNRAHAYKALVDQNLQEENADPDKGITMGLFNYPV
PF00579         aikaqlakgldpekaeivlnsdwleklelaellrdlgklgelnrmlqfks.vkkrlkq.n....egislg
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LMAADILIFDADLVPVGKDQIQHIEIARDIANRFNHIYQKPVLKAPQALTSEDSQTILGLDGRKMSKSYD
PF00579         eftYplLqaaDilllkadlvpgGsDQkqhielgrelarrfnkk....vfkkpvgltvp...lltgldGek
PF01921         --------lgVdfEpaGkDhaaaGgSvdvsskiaeeilg.geaPvgvvYelillkgge........kmss
PF01921         --------lgVdfEpaGkDhaaaGgSvdvsskiaeeilg.geaPvgvvYelillkgge........kmss


                         -         -         -         +         -         -         -:280
query           NTIAIFSMEKKLRKQVMKIITNSQMPEEKKDPNNCTIFAIYKSIASQTEIAALEEKYLAGGLGWGDAKQI
PF00579         KmSKSagnsaIfLddekesvkkkiqkavtdsdeevekllklktelsnelierleaelgkkpkkeaeella
PF01921         SkGnvitvedwlevaepevlrfliarkkPkk---------------------------------------
PF01921         SkGnvitvedwlevaepevlrfliarkkPkk---------------------------------------


                         -         *         -         -         -         -         +:350
query           LFEKINEYLRDAREKYDYYINNPKIVDDILNQGAAKVRPLAKDKLKEVKDIIGM----------------
PF00579         eevtklvhg-------------------------------------------------------------
PF01921         ----------------------------------------------------------------------
PF01921         ----------------------------------------------------------------------