[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30480.1


[Show Plain Result]

## Summary of Sequence Search
   1::121
  15::61   PF01022 0.0% 42.5531914893617  Bacterial regulatory protein, arsR family 
  17::63   PF01047 0.0% 31.9148936170213  MarR family 
   1::121


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLANIVDFQKALGDETRIRILMVIYQHQLCLCHLAHIFKLANSTLSKHLDILRRNGFIHKRKQGRFHYF
PF01022         --------------dptRlkIlklLaegelcvcelaeelglsqstvShHLkkLreaGLVek---------
PF01047         ----------------tqfviLrilyesgplsvseLakklgvsrstvtrvldrLEkkGlieRs-------


                         -         -         *         -         -         -         -:140
query           YFNSAYQQQLNWLFDILADDEIIQSDQKLVKQLIAQELEHLPEIHAKENIL-------------------
PF01022         ----------------------------------------------------------------------
PF01047         ----------------------------------------------------------------------