[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30541.1


[Show Plain Result]

## Summary of Sequence Search
   1::351
  30::227  PF02931 0.0% 25.130890052356  Neurotransmitter-gated ion-channel ligand binding d 
 235::334  PF02932 0.0% 21.2121212121212  Neurotransmitter-gated ion-channel transmembrane re 
   1::351


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRNIYKIILVLSIVAIFYSDIFGYGDIPPQKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLE
PF02931         -----------------------------skpvdVkvelslsqiidvdeknqeltlnvwlrqkWtDerLa
PF02932         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FDKNEEKTPYKLYQGDFQYDEVFEGWKPQISIINEIGTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRL
PF02931         wdpedyggikslrlpse......kiWlPdivlyNkadeeheittkntnlriesdGkvllsprlivkssCs
PF02932         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGK
PF02931         idlkkFPfDeqnCslkfeSwtyneeevdlkwkekkevvekeeidlsdflengewelveveakrkekatge
PF02932         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PQRISMLEFSISLERKPTNILLKVLIPLTLLVLAMWAIFWMDTKALSDRLNIAFIGILSVIAYQFLIEGE
PF02931         ysels.ysditftltlr-----------------------------------------------------
PF02932         ------------------------iiPcvliviLsvlvFyLpsdagpekvtLgItvlLtlTvflllirei


                         -         *         -         -         -         -         +:350
query           MPDIDYLTFTDGFLLLSFSILFSTVLESLAVYWLIKLNKDKLARKMDIFSRFVFPISYLVLITSLYFIYL
PF02931         ----------------------------------------------------------------------
PF02932         lPktSlvipligkyllftmivvtllieiavvvlnvhhrsp.rthkmpewvrkvf----------------


                         -         -         -         -         *         -         -:420
query           H---------------------------------------------------------------------
PF02931         ----------------------------------------------------------------------
PF02932         ----------------------------------------------------------------------