[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30570.1


[Show Plain Result]

## Summary of Sequence Search
   1::640
 540::638  PF02806 0.0% 43.8202247191011  Alpha amylase, C-terminal all-beta domain 
  34::118  PF02922 0.0% 38.2716049382716  Carbohydrate-binding module 48 (Isoamylase N-termin 
 183::259  PF00128 0.0% 32  Alpha amylase, catalytic domain 
 281::484  PF00128 0.0% 19.2771084337349  Alpha amylase, catalytic domain 
 502::543  PF00128 0.0% 20  Alpha amylase, catalytic domain 
   1::640


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKNKNSEQNTHSTIGEQDIHYFHEGKHIYAYEFMGAHKACEEGIEGIRFTTWAPNAKSICVIGDFNYWQV
PF02806         ----------------------------------------------------------------------
PF02922         ---------------------------------lGahydae.g.agvtfrvwapnAtrVelvlyfnnswd
PF00128         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EDKNYMEPITDAGLWSVFIPNAKNGDKYKFVVTNKDTNNYVYKSDPYAFFSELRPNTASIITTETQYTWS
PF02806         ----------------------------------------------------------------------
PF02922         aeeapmkr.kreggvWevflpgdlkegvyYkyrvtgpng.pnklllDp----------------------
PF00128         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           DDKWLEKRAKTNYYDNPMNVYELHLASWKTKNGKFLTYDELNETLPQYIKEMGYTHVEFMPLHEHPLDAS
PF02806         ----------------------------------------------------------------------
PF02922         ----------------------------------------------------------------------
PF00128         ------------------------------------------eKLd.YlkdlGvtaiwlsPifespq.sy
PF00128         ------------------------------------------eKLd.YlkdlGvtaiwlsPifespq.sy
PF00128         ------------------------------------------eKLd.YlkdlGvtaiwlsPifespq.sy


                         -         -         -         +         -         -         -:280
query           WGYQPTGFYSVNSRHGDIIGLKRLVDKLHNNDIGVILDWVPGHFCKDQHGLIYFDGSPCYEYQEPTKAIN
PF02806         ----------------------------------------------------------------------
PF02922         ----------------------------------------------------------------------
PF00128         hgYditdykkidpefGtledfkeLiskahekgikvilDlVvNHtsdehe---------------------
PF00128         hgYditdykkidpefGtledfkeLiskahekgikvilDlVvNHtsdehe---------------------
PF00128         hgYditdykkidpefGtledfkeLiskahekgikvilDlVvNHtsdehe---------------------


                         -         *         -         -         -         -         +:350
query           KGWGTHNFDLGRNEVKCFLISNAMYWINEFHIDGLRVDAVSNILYLNYDREDGQWIPNIYGGHENLEGIA
PF02806         ----------------------------------------------------------------------
PF02922         ----------------------------------------------------------------------
PF00128         flkslpdlnteneevvkelkkvvkfwldkg.vDGfRlDavkhisk........................e
PF00128         flkslpdlnteneevvkelkkvvkfwldkg.vDGfRlDavkhisk........................e
PF00128         flkslpdlnteneevvkelkkvvkfwldkg.vDGfRlDavkhisk........................e


                         -         -         -         -         *         -         -:420
query           FLKELNGVLKHTCKGVITIAEESSSWPDISTPVEKGGLGFDFKWNMGWMNDTLRYISLDPVYRKYHHNLI
PF02806         ----------------------------------------------------------------------
PF02922         ----------------------------------------------------------------------
PF00128         fwkeftqalneykeevftvgEvfgasdedarvdatesymeleslldfedfd.laekvkeksqlksitakk
PF00128         fwkeftqalneykeevftvgEvfgasdedarvdatesymeleslldfedfd.laekvkeksqlksitakk
PF00128         fwkeftqalneykeevftvgEvfgasdedarvdatesymeleslldfedfd.laekvkeksqlksitakk


                         -         -         +         -         -         -         -:490
query           TFSMVYHYSEKFILSISHDEVVHGKKSLINKMWGDLWNKYAGLRLYMSYMIGHPGKKLIFMGSEFVQFVE
PF02806         ----------------------------------------------------------------------
PF02922         ----------------------------------------------------------------------
PF00128         lkevlsktlselsedeeqvtflenHDqeR.........vlsrfgddsa...klklalallltlr------
PF00128         lkevlsktlselsedeeqvtflenHDqeR.........vlsrfgddsa...klklalallltlr------
PF00128         lkevlsktlselsedeeqvtflenHDqeR.........vlsrfgddsa...klklalallltlr------


                         *         -         -         -         -         +         -:560
query           WREYEQLQWQVVDQYESHKQTLHFFKKLNDLYHNETALWQCDYDHHGFRWIDADNSQQSILSFIRSSKDN
PF02806         -------------------------------------------------wvsaddeenkviaFeRkgkgd
PF02922         ----------------------------------------------------------------------
PF00128         -----------gsaweddeeaqe.hkflkslpdlnteneevvkelkk.vvkfw-----------------
PF00128         -----------gsaweddeeaqe.hkflkslpdlnteneevvkelkk.vvkfw-----------------
PF00128         -----------gsaweddeeaqe.hkflkslpdlnteneevvkelkk.vvkfw-----------------


                         -         -         -         *         -         -         -:630
query           KQKLIFICNFTPVTYYDYHLGVPDAGSYKEVFNSDNLEFGGSGQVMATEIFSSPQSSHGFEQRITIKIPP
PF02806         k.allvvfNfspskssedyrvglpeagtYrdvlnsddeeyggsg...sgkvf...vesngr...ltltip
PF02922         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           MATLVLKLIK------------------------------------------------------------
PF02806         prsalvlk--------------------------------------------------------------
PF02922         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------------------------
PF00128         ----------------------------------------------------------------------