[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30613.1


[Show Plain Result]

## Summary of Sequence Search
   1::528
 150::471  PF01645 0.0% 37.7049180327869  Conserved region in glutamate synthase 
 377::416  PF01070 0.0% 17.5  FMN-dependent dehydrogenase 
   1::528


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHISERRKWYIGFAVFVMVILLSLSLLHASIWFSIGFVAVLAVIAIYDVSQTKHSILRNFPIVGHMRYIL
PF01645         ----------------------------------------------------------------------
PF01070         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EFLRPEIQQYFIADNESEKPFGRELRSTIYRRAKGINDTVAFGTEKDIYRVGYEWVTHSLMPKHLDEIET
PF01645         ----------------------------------------------------------------------
PF01070         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RVKIGGSDCKQPYMASHLNISAMSFGALSANAVMALNKGAKLGGFYQCTGEGGLTKYHLQGGDLVFQIGT
PF01645         ---------epaleikkriltgamSyGalseeahealakamnrlgtksntGEGGedeerlkkakdlaikQ
PF01070         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GYFGCRTDDGKFSAEKFVEKANLDSVKMIEIKLSQGAKPSHGGVLPAAKITPEIAEIRGVSMGKDVLSPP
PF01645         vasgrFGvt.............eeyLvnakaleikiaQGakpgeGgqlpgekvseeiakiRnikpgvdli
PF01070         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AHSAFSTPIEFCYFIKQLRDLSNGKPIGFKLCIGSHVEFLAICKAMLETGIRPDFITVDGADGGTGAAPL
PF01645         SPaphhdiysiedlaqliedLkeinpeakvsvKlvaeagvgtiaag....vakanadiilidGldGGTGA
PF01070         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           EFSNHIGMPLEDSLIFVHNALVGCGLRDEIRIIASSKVATGFDMVRLFAMGADTCNSARAMMLAIGCIQS
PF01645         spkssikhaGlPlelalaevdqtLvenglrdrvsliadGglrtgadvvvalllGAdavgigtaalialgC
PF01070         --------------------------agrlevllDgGirrGsDvlkalAlGAdavlvGRpflygla----


                         -         -         +         -         -         -         -:490
query           RQCNNNTCPVGVATQNPRLEKALVVEDKMYRVYNFHKATIQSCLEIIGAMGLISTDDVEPENLKKRISVN
PF01645         imarvChtntCpvGvatqdpkLrkrlkfegkpervvnyllvlaeevrella-------------------
PF01070         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           EIKSYADLYDFIPERCLVDGNIPASFARSWEKARADSF--------------------------------
PF01645         ----------------------------------------------------------------------
PF01070         ----------------------------------------------------------------------