[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30665.1


[Show Plain Result]

## Summary of Sequence Search
   1::354
 145::335  PF01223 0.0% 40.1069518716578  DNA/RNA non-specific endonuclease 
   1::354


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTKKTSKQKDTKKQTTKKPINYIKIFILLALTIGGGFSGIFFDKFDLKEKFINFRHAVYNYFTSEPIKHY
PF01223         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TTKDNENITARFFSQSDEGKKQQQQSNEFDNLKQYPPVRTLPAVTDYCHGFLAYGNPSYGVTDGLGQANL
PF01223         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           YLCRDGYVVGYNYQTKEASWVAFELTKSKVANHLKRDDRFKEDSDVPFVYRATLDDYSRSGYDRGHLASY
PF01223         ----kgysvcynkerrranwvaekltganlaaskgvsvaaarqkdrfkedlripalfratpsdykgsgld


                         -         -         -         +         -         -         -:280
query           ASMDFSKKSADQSFLLSNMSPQKAGLNRQGWERLETDERIWANMYDSIYVYTGPIYKKQKIHKTIGDNKI
PF01223         RGHLaaaaadksstaaqkqtfnytNavPQwqtfNrgnWlrlEnlvrklvrsenrdvyVvtgplfvpr..v


                         -         *         -         -         -         -         +:350
query           AVPDYFFKIIYVPSKNQAIAFVMPNARVEKTKIANYRVSIKDIEQCTGLHFLTNISNRDAVINSVSSMWR
PF01223         ellgknkvavPthfwKvilsesadkaleaaafllpnanipeat..nleqvpvdei---------------


                         -         -         -         -         *         -         -:420
query           TTYL------------------------------------------------------------------
PF01223         ----------------------------------------------------------------------