[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30667.1


[Show Plain Result]

## Summary of Sequence Search
   1::139
   5::114  PF06903 0.0% 37.3831775700935  VirK protein 
   1::139


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKIITLSTLLLISLTSIAFSKELNNYSDILNAVKDGKNITIFVDFSNCKPEIKVSGQFSPKSIMIHNDS
PF06903         ----lllallaatslaaaaaadelnsyseileAlsaGkdvtvvidlsrCtpetaktpstkvrGgvriday


                         -         -         *         -         -         -         -:140
query           IIFSDTHFTRNNPQYLNEPILEYVVYKINGNNVNITIDILDANNSPMEHSKRITIGCQITKDQASFFSN-
PF06903         ritsdntlaFsdtHftvdnd...gkPilefirYrirkdgkaeft--------------------------