[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30738.1


[Show Plain Result]

## Summary of Sequence Search
   1::287
  10::266  PF00483 0.0% 27.5109170305677  Nucleotidyl transferase 
   1::287


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKIRKAVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAIEAGCKEIIFVTSSNKKSLEDHFDRN
PF00483         ---------aGGsGtRLwPltrtlakklvpvlgkerliqytlsrlansgieeiivvltqehrflvaeqlr


                         -         -         *         -         -         -         -:140
query           FELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQPEALGLGHAVLCAKPLVGIEDFAVILPDDLIYNHDC
PF00483         egsklg......................vevlialepegrgtAdAvalaaelledeksdelvlvLagDhl


                         +         -         -         -         -         *         -:210
query           GTGTLKQMVKAVEGTDIRGCIATQQVKREKTNSYGIVAKDNDNLIKAIVEKPAPEKAPSTNAVVGRYLLP
PF00483         ikd.....ayeeavkkaiekaadgtvtfgivpveeatgYGvieideegrverfvEKPkeaka.selassg


                         -         -         -         +         -         -         -:280
query           NKIFRCLESTSEGAGGEIQLTDAIAKLLDQDEKILSYEFKGTRYDCGSKLGFLIANYEIALQHQELGHKF
PF00483         iYvfnsgvllflakyleelkrgedeitdilpaaleegkealaflrkgeayWsDvGt--------------


                         -         *         -         -         -         -         +:350
query           KEYLQNR---------------------------------------------------------------
PF00483         ----------------------------------------------------------------------