[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30798.1


[Show Plain Result]

## Summary of Sequence Search
   1::268
  14::180  PF00480 0.0% 30  ROK family 
   1::268


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKEIQIKNRTVVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSEVEGI
PF00480         -------------gidlGgtkiela.lvdeegeilkrekvptp..ttpeellealvdlvekaeeqfgev.


                         -         -         *         -         -         -         -:140
query           GVGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGKQYENFVGIT
PF00480         ..gvgigvpGivnkdqgtivstPn.ikwadvdlvkkleerlnvpvvlendanaaalaEkvfgaakdvsnv


                         +         -         -         -         -         *         -:210
query           IGTGIGGGIINKGSLLKDSNCGAGEFGMLPYLDGILEDYCSGQFFIKKIGVEGVEILKRARNNDKDTINI
PF00480         iyvtigtGiGaGviingklirGangeaGeighilldenge------------------------------


                         -         -         -         +         -         -         -:280
query           YKQFGKHLGVAIKSIMYTLDPEVIIIAGSIISAREFFEKAMWDEIKTFAFINQLKKLK------------
PF00480         ----------------------------------------------------------------------