[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30829.1


[Show Plain Result]

## Summary of Sequence Search
   1::111
   2::91   PF01250 0.0% 41.1111111111111  Ribosomal protein S6 
   1::111


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKHYEVVLMIHPDQSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYVLFNIECPTES
PF01250         -rkYEtvlilrpdlseeevkaliekvkklleenggeivkveewgkrkLaYpIkkkkeGyYvlinfeaepe


                         -         -         *         -         -         -         -:140
query           LEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKEVI-----------------------------
PF01250         avaelerklrinedvlRfliv-------------------------------------------------