[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30867.1


[Show Plain Result]

## Summary of Sequence Search
   1::196
  48::89   PF00571 0.0% 23.8095238095238  CBS domain 
 131::174  PF00571 0.0% 15  CBS domain 
   1::196


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDLKEFKKIELSHFKDAKSVNYLRDDVNHLLYLDSPALDVFRDYKEHDALVVKADVNLKDVKTKLIDNHK
PF00571         -----------------------------------------------dvvtvppdetlsealeilrktgv
PF00571         -----------------------------------------------dvvtvppdetlsealeilrktgv


                         -         -         *         -         -         -         -:140
query           DFILVTDGEDKVIGSIALHYIQSQALNERARSSGTKPADLIANDIMLPIAKANVVSFSIIENSKIGHVVN
PF00571         srlpVvDedgrlvGiitlr-----------------------------------------pdetlseale
PF00571         srlpVvDedgrlvGiitlr-----------------------------------------pdetlseale


                         +         -         -         -         -         *         -:210
query           TLINSDYHHIIVYDKDKNGEKYIRGYFSLPYIRRKLSLDVYHVYQKQGISNLNRGI--------------
PF00571         ilrktgvsrlpVvDed....grlvGiitlrDllk------------------------------------
PF00571         ilrktgvsrlpVvDed....grlvGiitlrDllk------------------------------------