[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30912.1


[Show Plain Result]

## Summary of Sequence Search
   1::235
   5::158  PF00106 0.0% 24  short chain dehydrogenase 
   6::139  PF01370 0.0% 22.3140495867769  NAD dependent epimerase/dehydratase family 
   6::29   PF08659 0.0% 29.1666666666667  KR domain 
  48::147  PF08659 0.0% 16.6666666666667  KR domain 
   1::235


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSNRIVLITGATKRIGLATSLYLNNQGWQVIGIARSYIDNFPGELFLCDLANEEQTASTLIQINEIHGCP
PF00106         ----tvliTGGlgglGlalArwLveegarhlvlvsrredapgaaeliaelealgaevtvvacDvadrdal
PF01370         -----ilVtGgtGfiGsalveallekgyevvdnlirrtrseelaterlrvelvegdltdkdalerlfaee
PF08659         -----yLvtGGlgglGlelarwLaergar------------------aDvadrdavealleeveaeeppl
PF08659         -----yLvtGGlgglGlelarwLaergar------------------aDvadrdavealleeveaeeppl


                         -         -         *         -         -         -         -:140
query           DAIINNVGIAIPEPLGKISISALNDVYNLNVRSAVQVSQFFIEKMKLKEQCKIVNIASRAIFGVKNRTSY
PF00106         aallaeirkelgpldgvvhaagvlddglleeltperlervlapkvtgawllheltld....adlgafvlf
PF01370         .....qpdaVihlaaesg....vdassedpadfiennvvgtlnl....leaarkagvkrlvflsSsevY-
PF08659         rGvvhaAgvlrdallaemtaedlaavlapKvtGawnLhellad....epldffvlfSSiagvlgsagqan
PF08659         rGvvhaAgvlrdallaemtaedlaavlapKvtGawnLhellad....epldffvlfSSiagvlgsagqan


                         +         -         -         -         -         *         -:210
query           SAAKSALVGCTKTWALELAKYGICVNAIAPGPVDTELFRKTRPIGSSEEKEVLDSIPMMRIGKPEEIAAT
PF00106         SSvagvlgspgqaaYaaa----------------------------------------------------
PF01370         ----------------------------------------------------------------------
PF08659         yaaanaf---------------------------------------------------------------
PF08659         yaaanaf---------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           IAFLLSNEASFITGQVICVDGGGSL---------------------------------------------
PF00106         ----------------------------------------------------------------------
PF01370         ----------------------------------------------------------------------
PF08659         ----------------------------------------------------------------------
PF08659         ----------------------------------------------------------------------