[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30916.1


[Show Plain Result]

## Summary of Sequence Search
   1::106
   1::106  PF01906 0.0% 45.7142857142857  Domain of unknown function (DUF74) 
   1::106


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MILTTADTLGKREIIEYKGLVTGIIVRTPTITQGILGGLKNIIGGKNTSYTNVCKEARLHAEQEMINQAK
PF01906         mivtttesiegkeiteylgivtgetvrsrnvlkdifaglkdivGGelkayeekleeareealerlkeeAk


                         -         -         *         -         -         -         -:140
query           ELGANAIVAIRYDSSSLGGNTSGTEVFCYGTAVVVR----------------------------------
PF01906         elGAnavvgvrldtseigq.gamlevlayGTAVvve----------------------------------