[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30919.1


[Show Plain Result]

## Summary of Sequence Search
   1::206
 116::200  PF01227 0.0% 42.8571428571429  GTP cyclohydrolase I 
   1::206


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MMMKDKYCSKLGKSVQEHLIKLGLEQPREFNLDNDNKITIITKAYRQILDALGLYTDEFEKTPFRVARMF
PF01227         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TQEIFNGLDYANFPACALYENEFNYTGVLTQKNITIMSFCEHHFVPFEGTAEVSFIPKNNNIIGLCRINS
PF01227         ---------------------------------------------PffgkahvaYiP.ngkvvglsklar


                         +         -         -         -         -         *         -:210
query           ICDFFSRRPQIQERMTAQIFEALKFILSTEDVSVKIKAKHACVSLRGVNNQNSQTYTQMVGGVFAK----
PF01227         ivevfarrlqvqErlteqiadalsellkpkgvaVvieAeHlCmtmRGvekpgsktvtsal----------