[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD30942.1


[Show Plain Result]

## Summary of Sequence Search
   1::405
  41::154  PF08245 0.0% 31.4606741573034  Mur ligase middle domain 
   1::405


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTTLDFWLIVVVFVILCVYLIIENIVHNNSIKSIPIRIHVNGTRGKSSVARLIAAGVRAGGYRTVAKTTG
PF08245         ----------------------------------------TGTnGKTTtteliaallkaa..gktvgtag


                         -         -         *         -         -         -         -:140
query           TLARYIDVDGSETPVFRIGFSNIAEQVKIMFKARRAKADAIVIECMALQPLLQSLCELKLIKATHGVLTN
PF08245         .....................ntnneiglpallaeleekeadvavlElSsfglgekqlegl..lkpdiav


                         +         -         -         -         -         *         -:210
query           ARPDHLDVMGPTERDVAKALAATVPIGAKYFTAEDIHLDFFEYACKDRGSELIAATAQDAEKISDEEINK
PF08245         itnitedHldyhgt--------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FVYSEFKINVALALKVTDDLGIPREIALKGMWEATPDPGAMTEYNFNIKNAEINFANAFAANDPVSTKML
PF08245         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           WDKLCAKYSGCDKKVLVVNCRDDREDRSKQMAEAALGWQKQDLIVLIGTGTEVFTSFYKKYAKSLNKPMT
PF08245         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KVIVCEEMTPIQILEKTVDSNPANSYILVGVGNIKDIGMELVDYCDTSHKKKHNL---------------
PF08245         ----------------------------------------------------------------------