[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD31006.1


[Show Plain Result]

## Summary of Sequence Search
   1::509
  25::414  PF07690 0.0% 23.8235294117647  Major Facilitator Superfamily 
 472::501  PF07690 0.0% 36.6666666666667  Major Facilitator Superfamily 
  35::193  PF05977 0.0% 20.253164556962  Bacterial protein of unknown function (DUF894) 
 277::375  PF05977 0.0% 24.2105263157895  Bacterial protein of unknown function (DUF894) 
   1::509


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQASNTITVGFWSQKRTIVALAISLLALAEIVDLTIVAVAIPQIMGAIGANVETIADVTTVYIVTAAIFI
PF07690         ------------------------laaflaalarsilgpalplalaedlgispseigwlltlyslgyaia
PF07690         ------------------------laaflaalarsilgpalplalaedlgispseigwlltlyslgyaia
PF05977         ----------------------------------liqeVaaaWlmtslsasplmValvqaaatLPiflls
PF05977         ----------------------------------liqeVaaaWlmtslsasplmValvqaaatLPiflls


                         -         -         *         -         -         -         -:140
query           LLSGLIIEKYGIKRVALVSSVIFGISSIMCGLSTSLAEMIVFRAFQGMGGAFLPSVAQTYISTSFKNEEY
PF07690         sllaGrlsdrfGrrrvlllglllfalglllllfasslwalllvlrvlqGlgagalfpagaaliadwfpke
PF07690         sllaGrlsdrfGrrrvlllglllfalglllllfasslwalllvlrvlqGlgagalfpagaaliadwfpke
PF05977         llaGvlaDnldrRkvllvvqlllllasvlltvlaalgllspwlllaltfllgiGaalnapaWqasvgelv
PF05977         llaGvlaDnldrRkvllvvqlllllasvlltvlaalgllspwlllaltfllgiGaalnapaWqasvgelv


                         +         -         -         -         -         *         -:210
query           NKMMTIYSMVIVMGPIIGPVLGGAICENMSWEWIFYVNVPLCIVAFIIIAFMMEATQIKKIKIDYISFGF
PF07690         ergralgllsagfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaee
PF07690         ergralgllsagfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaee
PF05977         krddvpaAvaLnsvgvNiaRsvGPAlgGvlvaavgaalafavna.lsylaviv-----------------
PF05977         krddvpaAvaLnsvgvNiaRsvGPAlgGvlvaavgaalafavna.lsylaviv-----------------


                         -         -         -         +         -         -         -:280
query           MAIGVGCLELFIDNGNTNGWFSSIKMIILLAISLVSIGFFIWRGLIYSSVVKFKIFKNFNFVLACFLCFM
PF07690         l...............................................rkepaplvpawklllkppvlwl
PF07690         l...............................................rkepaplvpawklllkppvlwl
PF05977         ------------------------------------------------------------------raal
PF05977         ------------------------------------------------------------------raal


                         -         *         -         -         -         -         +:350
query           FVLLFSAAMAYLPTMLQQVYGYPVDLAGYITAPRGIAAIIGAMLTQSILVKKLGVRKTISLGMITFGVSC
PF07690         lialllfffvfsg..lltllplylqevlglspglllaglllgllaligaigalllgrls.drlgrrrrll
PF07690         lialllfffvfsg..lltllplylqevlglspglllaglllgllaligaigalllgrls.drlgrrrrll
PF05977         FglsasavlaLLPlvardelggdalvyGillgalGaGAvlgall.lsrlrrrlsserlvllaavalAlvl
PF05977         FglsasavlaLLPlvardelggdalvyGillgalGaGAvlgall.lsrlrrrlsserlvllaavalAlvl


                         -         -         -         -         *         -         -:420
query           LMQANFSPTANEFDIILTTAIQGLGMMMFFVPFMSVLVVGVADEDMGDMSGSFNFFRNFGSSVGTAFVAT
PF07690         lallllllaalglallaftssavwllvvlvliGfglglvfptllalasdlappeerGtasglfn------
PF07690         lallllllaalglallaftssavwllvvlvliGfglglvfptllalasdlappeerGtasglfn------
PF05977         lsla.lss..slwvavlvlllgGaa---------------------------------------------
PF05977         lsla.lss..slwvavlvlllgGaa---------------------------------------------


                         -         -         +         -         -         -         -:490
query           FISRNQQTTYLELSQNISSLNNNFQSWSHSLPMPDLATVALAKQQVLHQSSLLSYINSFYVVGILSLILA
PF07690         ---------------------------------------------------slgWravFlilailsllaa
PF07690         ---------------------------------------------------slgWravFlilailsllaa
PF05977         ----------------------------------------------------------------------
PF05977         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           IVPFLLKEPPTGAPVAVMH---------------------------------------------------
PF07690         vlvllllprep-----------------------------------------------------------
PF07690         vlvllllprep-----------------------------------------------------------
PF05977         ----------------------------------------------------------------------
PF05977         ----------------------------------------------------------------------