[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD31053.1


[Show Plain Result]

## Summary of Sequence Search
   1::455
  53::112  PF07724 0.0% 37.5  AAA domain (Cdc48 subfamily) 
 199::341  PF07724 0.0% 47.7611940298507  AAA domain (Cdc48 subfamily) 
  54::109  PF00004 0.0% 35.1851851851852  ATPase family associated with various cellular acti 
 247::344  PF00004 0.0% 28.2352941176471  ATPase family associated with various cellular acti 
  53::89   PF07728 0.0% 37.8378378378378  AAA domain (dynein-related subfamily) 
 253::274  PF07728 0.0% 22.7272727272727  AAA domain (dynein-related subfamily) 
 347::421  PF10431 0.0% 27.2727272727273  C-terminal, D2-small domain, of ClpB protein 
  17::32   PF01078 0.0% 43.75  Magnesium chelatase, subunit ChlI 
  52::75   PF01078 0.0% 50  Magnesium chelatase, subunit ChlI 
 258::275  PF01078 0.0% 38.8888888888889  Magnesium chelatase, subunit ChlI 
   8::77   PF00493 0.0% 26.865671641791  MCM2/3/5 family 
 260::276  PF00493 0.0% 29.4117647058824  MCM2/3/5 family 
 360::416  PF00493 0.0% 28.3018867924528  MCM2/3/5 family 
  40::116  PF06414 0.0% 20.2702702702703  Zeta toxin 
  49::87   PF00158 0.0% 28.2051282051282  Sigma-54 interaction domain 
 261::273  PF00158 0.0% 46.1538461538462  Sigma-54 interaction domain 
  17::80   PF05496 0.0% 30.9090909090909  Holliday junction DNA helicase ruvB N-terminus 
 247::276  PF05496 0.0% 31.0344827586207  Holliday junction DNA helicase ruvB N-terminus 
   1::455


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTQIMTPKTIVHELERHIIGQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARR
PF07724         ----------------------------------------------------silllgptgvGktelaka
PF07724         ----------------------------------------------------silllgptgvGktelaka
PF00004         -----------------------------------------------------vllyGppGtGKTllaka
PF00004         -----------------------------------------------------vllyGppGtGKTllaka
PF07728         ----------------------------------------------------dvlLvGppGtgKselaer
PF07728         ----------------------------------------------------dvlLvGppGtgKselaer
PF10431         ----------------------------------------------------------------------
PF01078         ----------------dvkGqeeakraleiaa-------------------HnlllvGppGsGKtmlakr
PF01078         ----------------dvkGqeeakraleiaa-------------------HnlllvGppGsGKtmlakr
PF01078         ----------------dvkGqeeakraleiaa-------------------HnlllvGppGsGKtmlakr
PF00493         -------eklvksiapsiyghedvkkaillqlfggvkkkaedktklrgdi...nvllvGdpgtaKSqlLk
PF00493         -------eklvksiapsiyghedvkkaillqlfggvkkkaedktklrgdi...nvllvGdpgtaKSqlLk
PF00493         -------eklvksiapsiyghedvkkaillqlfggvkkkaedktklrgdi...nvllvGdpgtaKSqlLk
PF06414         ---------------------------------------llsnkkvpeqekpkavllgGqpGAGKtslae
PF00158         ------------------------------------------------ktdltvlitGesGtGKellAra
PF00158         ------------------------------------------------ktdltvlitGesGtGKellAra
PF05496         ----------------eyigqekvkeklkifiea........akkree.aldhvllyGpPGlGkttlaki
PF05496         ----------------eyigqekvkeklkifiea........akkree.aldhvllyGpPGlGkttlaki


                         -         -         *         -         -         -         -:140
query           LAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVKMKREEAKEKVTEKAARLAEDRILDVLIPPA
PF07724         laellfvkkekkliradaselle....eeevehlvsrligap----------------------------
PF07724         laellfvkkekkliradaselle....eeevehlvsrligap----------------------------
PF00004         vakelgvefleisgsell.skyvges.ekkirelfkeak-------------------------------
PF00004         vakelgvefleisgsell.skyvges.ekkirelfkeak-------------------------------
PF07728         laealnreveyvqltrdtt---------------------------------------------------
PF07728         laealnreveyvqltrdtt---------------------------------------------------
PF10431         ----------------------------------------------------------------------
PF01078         lpsll-----------------------------------------------------------------
PF01078         lpsll-----------------------------------------------------------------
PF01078         lpsll-----------------------------------------------------------------
PF00493         yveklap---------------------------------------------------------------
PF00493         yveklap---------------------------------------------------------------
PF00493         yveklap---------------------------------------------------------------
PF06414         llleelaagnivridaDelrkyh...payrelekkdpkeaseltqk------------------------
PF00158         iheaskrkkkpfvavnc-----------------------------------------------------
PF00158         iheaskrkkkpfvavnc-----------------------------------------------------
PF05496         iakelgvelk------------------------------------------------------------
PF05496         iakelgvelk------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RTSESKVGFANEPAEDAASKKEKENKTREIFRKKIQNGELDDKEIEIEVAVAPKTIGVMGPPGMEDMTSQ
PF07724         ----------------------------------------------------------lgptgvGktela
PF07724         ----------------------------------------------------------lgptgvGktela
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF10431         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF00493         ----------------------------------------------------------------------
PF00493         ----------------------------------------------------------------------
PF00493         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF00158         ----------------------------------------------------------------------
PF00158         ----------------------------------------------------------------------
PF05496         ----------------------------------------------------------------------
PF05496         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           LQDLFSSLSTDKKKNKKMRIKDAIKLAQDEEAAKLVNEEDIKARALEAVEQNGIVFLDEIDKVCRKSSNS
PF07724         kalaellfv........kkekkliradaselleeeevehlvsrligappgyvgaeegGivllDEidKihp
PF07724         kalaellfv........kkekkliradaselleeeevehlvsrligappgyvgaeegGivllDEidKihp
PF00004         ------------------------------------sekkirelfkeakekapsvlfiDEidalaksr..
PF00004         ------------------------------------sekkirelfkeakekapsvlfiDEidalaksr..
PF07728         ------------------------------------------splvraaregeilvlDEverae------
PF07728         ------------------------------------------splvraaregeilvlDEverae------
PF10431         ----------------------------------------------------------------------
PF01078         -----------------------------------------------slahnGvLfLDElpefkr-----
PF01078         -----------------------------------------------slahnGvLfLDElpefkr-----
PF01078         -----------------------------------------------slahnGvLfLDElpefkr-----
PF00493         -------------------------------------------------adkGvcciDefdkmkee----
PF00493         -------------------------------------------------adkGvcciDefdkmkee----
PF00493         -------------------------------------------------adkGvcciDefdkmkee----
PF06414         ----------------------------------------------------------------------
PF00158         --------------------------------------------------dgGtLfLDeigel-------
PF00158         --------------------------------------------------dgGtLfLDeigel-------
PF05496         ------------------------------------kagdlaa.lltnleekdvlfideihrlsra----
PF05496         ------------------------------------kagdlaa.lltnleekdvlfideihrlsra----


                         -         *         -         -         -         -         +:350
query           GADVSREGVQRDLLPLVEGSTVSTKYGVIKTDHILFIASGAFHVAKPSDLIPELQGRLPIRVELKSLEIE
PF07724         k.essgadvSregVqrdLLqileggtltdkqgrkvdtknilfImtgafgsskisdesrske---------
PF07724         k.essgadvSregVqrdLLqileggtltdkqgrkvdtknilfImtgafgsskisdesrske---------
PF00004         gseseeeervvnqLlteldglkkk.......eskvlvigatnr....pdkldpallrgRfdrki------
PF00004         gseseeeervvnqLlteldglkkk.......eskvlvigatnr....pdkldpallrgRfdrki------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF10431         ------------------------------------------------------------------Lske
PF01078         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF00493         ----------------------------------------------------------------------
PF00493         ----------------------------------------------------------------------
PF00493         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF00158         ----------------------------------------------------------------------
PF00158         ----------------------------------------------------------------------
PF05496         ----------------------------------------------------------------------
PF05496         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DFVRILREPDCSILKQYIALMKTEGIDLSFEEDAIRKIAEIAYKVNEEVENIGARRLHTVMERLLEKISF
PF07724         ----------------------------------------------------------------------
PF07724         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF10431         elkkIvdk...alkklekrlae.rgvelevtdealdalaekgyd.....peyGARpLrriiereiedpla
PF01078         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF00493         ---------dkellrkYiayarek.ikPklseeakeklseaYvelRkeees...kksipitvrqle----
PF00493         ---------dkellrkYiayarek.ikPklseeakeklseaYvelRkeees...kksipitvrqle----
PF00493         ---------dkellrkYiayarek.ikPklseeakeklseaYvelRkeees...kksipitvrqle----
PF06414         ----------------------------------------------------------------------
PF00158         ----------------------------------------------------------------------
PF00158         ----------------------------------------------------------------------
PF05496         ----------------------------------------------------------------------
PF05496         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           DAPELVEKNINITTDYVNEKLGNLVKNKDLSQYIL-----------------------------------
PF07724         ----------------------------------------------------------------------
PF07724         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF00004         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF07728         ----------------------------------------------------------------------
PF10431         e---------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF01078         ----------------------------------------------------------------------
PF00493         ----------------------------------------------------------------------
PF00493         ----------------------------------------------------------------------
PF00493         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF00158         ----------------------------------------------------------------------
PF00158         ----------------------------------------------------------------------
PF05496         ----------------------------------------------------------------------
PF05496         ----------------------------------------------------------------------