[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD31100.1


[Show Plain Result]

## Summary of Sequence Search
   1::248
   4::128  PF01571 0.0% 34.1463414634146  Aminomethyltransferase folate-binding domain 
   1::248


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTFQYINFKILEVSGVDTKKFLQGLTTADLNGLSIDNDILLTAFANLKGRIISLCFVKFISNEKLLLSVE
PF01571         ---dvshmgkievsGpdalkfLqrlltndvsklk.pgsatytlllnekGgilddlivyrlgedefllvvn


                         -         -         *         -         -         -         -:140
query           QEVFENLLAWLKKYGMFSKVSFNPNDDYALFFTKTGFLNHDILTKGSLTSEMTFEQVRKENIINKLATIN
PF01571         aaaaekllawlekylvkskveledltdelal.lalqGpkarellqelvdldleelpff------------


                         +         -         -         -         -         *         -:210
query           AANFEKFLPAELDLDNVDKVVCYTKGCYMGQEVIARMHYKAKLKKELAVVKSESDIDDFDLKDSEGKPLA
PF01571         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NVVNKVFVDNQCYMLVVFHKEASEQEYQLDDGKIITKC--------------------------------
PF01571         ----------------------------------------------------------------------