[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD31135.1


[Show Plain Result]

## Summary of Sequence Search
   1::292
  60::129  PF04542 0.0% 31.4285714285714  Sigma-70 region 2 
 160::181  PF04545 0.0% 40.9090909090909  Sigma-70, region 4 
 236::286  PF04545 0.0% 38.7755102040816  Sigma-70, region 4 
 161::199  PF04539 0.0% 47.3684210526316  Sigma-70 region 3 
 253::280  PF04539 0.0% 35.7142857142857  Sigma-70 region 3 
  23::49   PF00140 0.0% 40.7407407407407  Sigma-70 factor, region 1.2 
   1::292


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MANKKLLPATKTKTLPVVSDNNLSAYLNFVNTLPVLSLEQEQELARRYKYKKDLDAAQQLVLSHLRFVTK
PF04542         -----------------------------------------------------------lverylplvrr
PF04545         ----------------------------------------------------------------------
PF04545         ----------------------------------------------------------------------
PF04539         ----------------------------------------------------------------------
PF04539         ----------------------------------------------------------------------
PF00140         ----------------------vrlYLrEIgrvpLLTaeEEveLArrie---------------------


                         -         -         *         -         -         -         -:140
query           IARNFSGYGLSIADLIQEGNIGLMKAVSKFDPDQGVRLLSFAVHWIKAEMHDYVLKNWKIVKVATTKAQR
PF04542         larrllgsgadaeDlvQeaflrllraverfdpergvkfsawlltiirnaildalrrrrr-----------
PF04545         ----------------------------------------------------------------------
PF04545         ----------------------------------------------------------------------
PF04539         ----------------------------------------------------------------------
PF04539         ----------------------------------------------------------------------
PF00140         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KLFFNLRSSKDKIGWLSSENIKELAEELGVKEETVIEMEKRMCQGDASLDLPYTDDDGEQTSQQSLYLED
PF04542         ----------------------------------------------------------------------
PF04545         -------------------TleEiGerlgisrerVrqiekr-----------------------------
PF04545         -------------------TleEiGerlgisrerVrqiekr-----------------------------
PF04539         --------------------peEiAeelgiseekvrevle.aarepvsldlpvgeeedg-----------
PF04539         --------------------peEiAeelgiseekvrevle.aarepvsldlpvgeeedg-----------
PF00140         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KSSNIEHQVVQQDYYDNFKAIVKDVLSGFDTRTKDIIMSRYLLDNKATLQDLAAKYNISAERVRQIEEDA
PF04542         ----------------------------------------------------------------------
PF04545         -------------------------LasLpererevlelrf..geglTleEiGerlgisrerVrqiekrA
PF04545         -------------------------LasLpererevlelrf..geglTleEiGerlgisrerVrqiekrA
PF04539         ------------------------------------------lgRePtpeEiAeelgiseekvrevleaa
PF04539         ------------------------------------------lgRePtpeEiAeelgiseekvrevleaa
PF00140         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LAKLKKAIKNRS----------------------------------------------------------
PF04542         ----------------------------------------------------------------------
PF04545         lrkLRk----------------------------------------------------------------
PF04545         lrkLRk----------------------------------------------------------------
PF04539         ----------------------------------------------------------------------
PF04539         ----------------------------------------------------------------------
PF00140         ----------------------------------------------------------------------