[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD31158.1


[Show Plain Result]

## Summary of Sequence Search
   1::364
   2::167  PF01612 0.0% 37.3493975903614  3'-5' exonuclease 
 216::254  PF00570 0.0% 33.3333333333333  HRDC domain 
   1::364


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIINTNKQLNNVIEILKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEFKKLKEIFEDK
PF01612         -ivtteeeleelieelknlkvvavDtEttsldlisatlrlaliqigtkeeayiidpleleddlellkkll
PF00570         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DILKIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLGFQTQSSLKTLLKEILDIEIEKESQFSDWRNRP
PF01612         edenitkVghnakfDlevlardfgielenlfdtmlaaavldyeeshsLasLaekllgeleldkeeqiakw
PF00570         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LTQNQLNYAIKDVEYLIQLKEYLQQQLAKSEYQDFFEQELIEVQKTQFNSIENIHAKIGNIQKFDEKTQR
PF01612         qkarplleeqleYAaeDadvllrlfkk-------------------------------------------
PF00570         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NAILIAQWRETIAQEKNIPVRFIFNNKILYTIAHINPKSLNSFEHSELKSLKPWIKKGVVTALNSSKSLD
PF01612         ----------------------------------------------------------------------
PF00570         -----rewReelAreedvppyvilsdktLleiAeklPttleeLl--------------------------


                         -         *         -         -         -         -         +:350
query           QVTLEQTSGSKLSTELNDKIIDFFDTYTKQLKFDSSIIASRKDIRSLAYNLNIDTNYKNNKLLNGWRYEI
PF01612         ----------------------------------------------------------------------
PF00570         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VGKKLKEYILSNTK--------------------------------------------------------
PF01612         ----------------------------------------------------------------------
PF00570         ----------------------------------------------------------------------