[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD31166.1


[Show Plain Result]

## Summary of Sequence Search
   1::240
  18::224  PF01048 0.0% 28.6407766990291  Phosphorylase superfamily 
   1::240


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLLPTPHIETLRKEEFAKTVIMPGDPLRAKYIADNYLENVVRVNAVRNMFGYTGTYKGKKVSVMGSGMGM
PF01048         -----------------kiaiivgspgevallaespleetpygregrggkfvtGtlkgkpvvlvstGiGk


                         -         -         *         -         -         -         -:140
query           PSMGIYAYELFKYYDVDNIIRVGSAGSYKAEFKVYDVVLIEESYCESNFIEIVTGSKTSDVRSSEELNKE
PF01048         pnaaviatarllkefgvkaiirtGtaGglnpdlkvGdvvipddainfdgtsplygpkeegegapdvaeak


                         +         -         -         -         -         *         -:210
query           LIASAQRQDIELKKAKAHCTDVFYRKNSDDYKKIVKKYNCDLVEMETAALFATAAELGKKASAVVTISDS
PF01048         adpellallkeaaealgikvhrGvvatgdgfyaeteaelr.llrrlgadaveMEtaavaqvArelgvpfa


                         -         -         -         +         -         -         -:280
query           FITGESTTAQQREQSFTNMMEVALGTIKEN----------------------------------------
PF01048         airvvsDlaaggad--------------------------------------------------------