[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD31211.1


[Show Plain Result]

## Summary of Sequence Search
   1::412
  15::228  PF07690 0.0% 21.0280373831776  Major Facilitator Superfamily 
 231::386  PF07690 0.0% 21.9354838709677  Major Facilitator Superfamily 
  38::197  PF05977 0.0% 22.7848101265823  Bacterial protein of unknown function (DUF894) 
 235::403  PF05977 0.0% 20.2380952380952  Bacterial protein of unknown function (DUF894) 
  35::158  PF00083 0.0% 23.728813559322  Sugar (and other) transporter 
 165::227  PF00083 0.0% 34.0425531914894  Sugar (and other) transporter 
 238::409  PF00083 0.0% 20.8333333333333  Sugar (and other) transporter 
   1::412


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTVRQTLLIIITPIIAMCVLSFGNGFFTTYSSIELNDLGRSSLMIGIISAAYFFGMTAGSYFSQFTIIRV
PF07690         --------------laaflaalarsilgpalplalaedlgispseigwlltlyslgyaiasllaGrlsdr
PF07690         --------------laaflaalarsilgpalplalaedlgispseigwlltlyslgyaiasllaGrlsdr
PF05977         -------------------------------------lggdalvyGillgalGaGAvlgalllsrlrrrl
PF05977         -------------------------------------lggdalvyGillgalGaGAvlgalllsrlrrrl
PF00083         ----------------------------------e.....ssvlsglivssflvgaliGslfaglladrf
PF00083         ----------------------------------e.....ssvlsglivssflvgaliGslfaglladrf
PF00083         ----------------------------------e.....ssvlsglivssflvgaliGslfaglladrf


                         -         -         *         -         -         -         -:140
query           GYIRAFVLFASLMAISTLIVGANKSVAVWILFRFLCGYSLAALFIIIESWCILSSDKKNRGLIFSIYLFV
PF07690         fGrrrvlllglllfalglllllfasslwalllvlrvlqGlgagalfpagaaliadwfpkeergralglls
PF07690         fGrrrvlllglllfalglllllfasslwalllvlrvlqGlgagalfpagaaliadwfpkeergralglls
PF05977         sserlvllaavalAlvllslalssslwvavlvlllgGaaWiaalstlnvavqlavprWvrgRalsvYltv
PF05977         sserlvllaavalAlvllslalssslwvavlvlllgGaaWiaalstlnvavqlavprWvrgRalsvYltv
PF00083         GRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgvGlisvlvPmyisEiApkklrgalgsly
PF00083         GRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgvGlisvlvPmyisEiApkklrgalgsly
PF00083         GRkksllvalvlfvigavlqaaakakksvwvlivgRvivGlgvGlisvlvPmyisEiApkklrgalgsly


                         +         -         -         -         -         *         -:210
query           YYGTQALSQLMINVHFSNGLLAYCFISSLCSIAIVLMAFTKTVAPVPHSEEIYSPAKIIKKVPLAMVASV
PF07690         agfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaeelrkepaplvp
PF07690         agfslGailgpllggllasslgWravFlilailsllaavlvllllprepperkrkspaeelrkepaplvp
PF05977         laGglaaGsllWGtvaealslelaLllaavalllg..allllllrlpegeeadlaps-------------
PF05977         laGglaaGsllWGtvaealslelaLllaavalllg..allllllrlpegeeadlaps-------------
PF00083         qlaitvGilvaaii.glg------valvlfvigavlqaaakak................ksvwvlivgRv
PF00083         qlaitvGilvaaii.glg------valvlfvigavlqaaakak................ksvwvlivgRv
PF00083         qlaitvGilvaaii.glg------valvlfvigavlqaaakak................ksvwvlivgRv


                         -         -         -         +         -         -         -:280
query           IGGSLLGSIYTLLPIFLVRVGSDHDMISVLMMTTILGGMLLQVPIGKLSDLIDRRKVIFLAGAGIFITSI
PF07690         awklllkppvlwlliall--gispseigwlltlyslgyaiasllaGrlsdrfGrrr.vlllglllfalgl
PF07690         awklllkppvlwlliall--gispseigwlltlyslgyaiasllaGrlsdrfGrrr.vlllglllfalgl
PF05977         ------------------------lmValvqaaatLPifllsllaGvlaDnldrRkvllvvqlllllasv
PF05977         ------------------------lmValvqaaatLPifllsllaGvlaDnldrRkvllvvqlllllasv
PF00083         ivGlgvGlisvlvPmyi----------glivssflvgaliGslfaglladrfGRkksllvalvlfvigav
PF00083         ivGlgvGlisvlvPmyi----------glivssflvgaliGslfaglladrfGRkksllvalvlfvigav
PF00083         ivGlgvGlisvlvPmyi----------glivssflvgaliGslfaglladrfGRkksllvalvlfvigav


                         -         *         -         -         -         -         +:350
query           FIFAFHTSYFLFAIIMFIFGGSAFVIYPLSISHASDFLNENEILGAIGVLTIAYGLGSVISPVVISGVMS
PF07690         llllfasslwalllvlrvlqGlgagalfpagaaliadwfpkeergralgllsagfslGailgpllgglla
PF07690         llllfasslwalllvlrvlqGlgagalfpagaaliadwfpkeergralgllsagfslGailgpllgglla
PF05977         lltvlaalgllspwlllaltfllgiGaalna.paWqasvgelvkrddvpaAvaLnsvgvNiaRsvGPAlg
PF05977         lltvlaalgllspwlllaltfllgiGaalna.paWqasvgelvkrddvpaAvaLnsvgvNiaRsvGPAlg
PF00083         lqaaakakksvwvlivgRvivGlgvGlisvlvPmyisEiA....pkklrgalgslyqlaitvGilvaaii
PF00083         lqaaakakksvwvlivgRvivGlgvGlisvlvPmyisEiA....pkklrgalgslyqlaitvGilvaaii
PF00083         lqaaakakksvwvlivgRvivGlgvGlisvlvPmyisEiA....pkklrgalgslyqlaitvGilvaaii


                         -         -         -         -         *         -         -:420
query           VFGPFGFFIITALLSISLCLYSAYRISVRKSATDRATFTIATPESLNFTEAQEIISEKSSEE--------
PF07690         sslgWravFlilailsllaavlvllllprepperkr----------------------------------
PF07690         sslgWravFlilailsllaavlvllllprepperkr----------------------------------
PF05977         GvlvaavgaalafavnalsylavivalarwkrevrksalprEkllaalraglR-----------------
PF05977         GvlvaavgaalafavnalsylavivalarwkrevrksalprEkllaalraglR-----------------
PF00083         glglnktsnadgwrillglqlvpallllllllflpeSprylvlkgkleeArevlkklrg-----------
PF00083         glglnktsnadgwrillglqlvpallllllllflpeSprylvlkgkleeArevlkklrg-----------
PF00083         glglnktsnadgwrillglqlvpallllllllflpeSprylvlkgkleeArevlkklrg-----------