[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for ftul2:ACD31283.1


[Show Plain Result]

## Summary of Sequence Search
   1::365
  99::288  PF00953 0.0% 40.5063291139241  Glycosyl transferase family 4 
  69::81   PF10555 0.0% 76.9230769230769  Phospho-N-acetylmuramoyl-pentapeptide-transferase s 
   1::365


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLIYLFEWLSHYFKGLEVFSSYISVRIIMISITSLLITLALGRPMISWLQKMQIGQIVRDDGPQSHFSKR
PF00953         ----------------------------------------------------------------------
PF10555         --------------------------------------------------------------------Kk


                         -         -         *         -         -         -         -:140
query           NTPTMGGVLILSSVIISCLLWGDLTSIYLWILILVVIFFGAIGFFDDYLKLVLKHPKGLRAKHKFALQSI
PF00953         ----------------------------lllllltillllllGflDDl........lglsarlklilqil
PF10555         gTPTMGGvlii-----------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           FSIVLAIVLFYLLSKNGQMSLSIPFSKSLYIPMGIVIFVVLAFFIINGSSNAVNLTDGLDGLAIVPVVLV
PF00953         aallliltld......slttlgllls.ealielglvllvlltllaivgviNavNllDGldGlaagvsiii
PF10555         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AAGLGIYAYIETNSTLANYLLFNYLGNPGLAEVAVFCAAVCGSGLAFLWFNSHPAEVFMGDVGSLTLGAV
PF00953         alalavla...............lia..gsselallslallgallGFllfNrypakiFmGDsGSlflGfv
PF10555         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LGVIAVMVRQELIFFIMGLLFVVEALSVMLQVGSYKLRNGKRIFRMAPIHHHFELKGWPETKVVIRFWII
PF00953         lavlaill--------------------------------------------------------------
PF10555         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           SLILFLIGLAAIKVR-------------------------------------------------------
PF00953         ----------------------------------------------------------------------
PF10555         ----------------------------------------------------------------------